(data stored in ACNUC7421 zone)

EMBL: CP000075.PE100

CP000075.PE100       Location/Qualifiers
FT   CDS_pept        complement(112435..112968)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Psyr_0100"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Psyr_0100"
FT                   /db_xref="EnsemblGenomes-Tr:AAY35174"
FT                   /db_xref="InterPro:IPR021225"
FT                   /db_xref="UniProtKB/TrEMBL:Q500J8"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAY35174.1"
FT                   /translation="MPMDPQSIDTNKVAHCTFELTGQPMSLLKCSNNESYEAFSGITGY
FT                   ANDPAQVSSAKNGPLPPGRYYILNRESGGRLGWLRDPITDLIARTDRSDWFSLYRDDGE
FT                   IDDRTIIDNVERENFRLHPVGPLGLSEGCVTMTSKLGFEQLSIYLHNMEGDRLPGSGQK
FT                   YFGILDVIDPRNTK"
     atgcccatgg atccccaatc aattgatacc aataaagtag cgcactgcac ttttgaattg        60
     acaggccagc ccatgagcct gctcaagtgc agtaataatg aaagctacga ggctttttct       120
     ggaataactg gctatgccaa tgatcctgcc caagtgagca gcgcgaaaaa cgggccgctc       180
     ccgccgggcc gctactatat tctgaacagg gaaagtggag ggagactggg ctggctgaga       240
     gaccccataa ctgacctaat tgcaagaacc gatcgcagcg attggttctc actgtaccgg       300
     gacgatgggg aaattgatga tcgcacaata attgacaacg ttgaaagaga aaacttcagg       360
     ctgcatcctg taggcccgtt aggcttgagc gaggggtgtg tgacaatgac atcaaaactc       420
     ggttttgagc aactgagtat ttacctacac aacatggaag gggataggct tccaggttcc       480
     ggacaaaaat atttcggaat cctagacgtt atcgacccga ggaataccaa gtga             534
//

If you have problems or comments...

PBIL Back to PBIL home page