(data stored in ACNUC7421 zone)

EMBL: CP000075.PE101

CP000075.PE101       Location/Qualifiers
FT   CDS_pept        complement(112987..113487)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Psyr_0101"
FT                   /product="Protein of unknown function DUF796"
FT                   /db_xref="EnsemblGenomes-Gn:Psyr_0101"
FT                   /db_xref="EnsemblGenomes-Tr:AAY35175"
FT                   /db_xref="InterPro:IPR008514"
FT                   /db_xref="InterPro:IPR036624"
FT                   /db_xref="UniProtKB/TrEMBL:Q500J7"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAY35175.1"
FT                   /translation="MAFDAYLKIDGIPGEALDAQFKDWIEMENFDLGASQSASVTATSA
FT                   GGATSGRARMSDLFFRKTVDKATPKLHEACCSGKHFKEVTLAVNRAGTDKLKYLEIVLE
FT                   EVIISSVSLNGNGGVEGGFPTETVRLNYGRIKMTYTQQKRADGQGGGQVVGGWDAISNK
FT                   VYA"
     atggcctttg atgcgtattt gaaaatcgac ggaattccag gtgaagctct tgacgctcaa        60
     tttaaggact ggatcgaaat ggaaaatttc gacctaggag caagccagtc cgcctcggtc       120
     actgcgacca gtgcaggcgg agcaacgagt ggtcgtgctc gtatgagtga cctcttcttc       180
     cgcaaaactg tggacaaagc caccccaaag ctgcacgaag cctgctgcag tggaaagcac       240
     ttcaaagagg tcacactcgc ggtcaaccgt gcaggaacag acaagctcaa atatttggaa       300
     atagtacttg aagaggtcat tatttcctcc gtttcactta acggtaacgg aggtgtagag       360
     ggcggctttc ccacagaaac ggtacgtctg aattatggcc gtatcaaaat gacctataca       420
     caacaaaaac gtgcagatgg gcaaggtggc ggccaggtcg taggcggttg ggatgccatt       480
     tccaacaagg tatacgcctg a                                                 501
//

If you have problems or comments...

PBIL Back to PBIL home page