(data stored in ACNUC7421 zone)

EMBL: CP000075.PE103

CP000075.PE103       Location/Qualifiers
FT   CDS_pept        complement(114514..114891)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Psyr_0103"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Psyr_0103"
FT                   /db_xref="EnsemblGenomes-Tr:AAY35177"
FT                   /db_xref="InterPro:IPR019650"
FT                   /db_xref="UniProtKB/TrEMBL:Q500J5"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAY35177.1"
FT                   /translation="MKLDKDLVREILLAIEASDKTPDSWIDLTIENHSKDEASYHVMLL
FT                   HEAGFIVAQDLCSMSDFDWRPKRLTIRGHEFLDTIRDREVWRLTKAGAEKAGGVSLTVM
FT                   LEIGKAYGKQVLKDRLGIDLP"
     atgaagctcg acaaggattt ggtgcgcgaa attctgctgg ccatcgaagc cagcgacaaa        60
     acccctgatt cttggattga tctaaccatc gaaaaccaca gcaaggatga ggcgtcctat       120
     cacgtgatgc tgctacacga ggcaggtttc atcgtggcgc aagatctttg ctctatgagt       180
     gatttcgatt ggcggccaaa acgactgacg atcagaggcc acgagttcct cgatacaatt       240
     cgagatcgag aagtttggcg cctgactaaa gccggtgcag agaaagctgg cggggtaagc       300
     cttacggtga tgctggaaat aggcaaagca tacggaaagc aagtactcaa agatcgtctg       360
     ggaattgatc ttccgtga                                                     378
//

If you have problems or comments...

PBIL Back to PBIL home page