(data stored in SCRATCH zone)

EMBL: CP000075.PE104

CP000075.PE104       Location/Qualifiers
FT   CDS_pept        115713..116873
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Psyr_0104"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Psyr_0104"
FT                   /db_xref="EnsemblGenomes-Tr:AAY35178"
FT                   /db_xref="GOA:Q500J4"
FT                   /db_xref="InterPro:IPR000157"
FT                   /db_xref="InterPro:IPR021729"
FT                   /db_xref="InterPro:IPR035897"
FT                   /db_xref="InterPro:IPR037126"
FT                   /db_xref="UniProtKB/TrEMBL:Q500J4"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAY35178.1"
FT                   /translation="MSLKIFVSYAKEDRLQALKYYDLLVHDGMVPWIDVKHILPGQNWE
FT                   AEIDKAFLEANVVMLLLSNKSVNKRGFVQREANDAIERLRYKQPTDIYVLPLLLEQCEV
FT                   PTHISGRLQYIDLTTTGAWIQVQASLQLAAEQQSIEIKHGSNAGPFKVFSEQLKDYWEG
FT                   APGHDIKIEYPRFESASLKSAAEELSLYFGGRATLGLIKSRQKPWDQQKDLFPETGGYI
FT                   SLNGRWDGFGVVHATDEILSLIYEVSWYGAGAAHPNSHFETYNFSLHERLLLLSLDDFF
FT                   CDHTAALQRISELCIAELCREYWRRTGEKPGEDQVEWFTNGAAGTEENLSAFTVGANHF
FT                   TFLFAPYQVSSYADGRWSVEISFYDLLEFLKPDGPHTYAAVRLGLE"
     atgtcgctca aaatatttgt gagttacgcc aaagaagaca ggttgcaagc actgaagtat        60
     tacgacctcc ttgtacatga tggcatggtt ccatggatcg atgtgaagca catcctgccg       120
     ggacaaaatt gggaagcgga gatcgacaaa gctttcctgg aggcaaatgt tgtaatgctg       180
     ctgcttagca ataagagcgt taacaaacgt ggtttcgttc aaagggaggc aaacgacgct       240
     atagagcgcc tcaggtacaa acagccaact gacatctatg tgttacctct actactggag       300
     caatgtgagg tacctactca tatatctgga cgcctccaat atattgattt aactacgacg       360
     ggagcatgga tacaggttca agcatctctt caattagctg ctgagcaaca gtccatagaa       420
     attaaacatg gttcaaacgc aggcccgttt aaagttttct cagagcagtt aaaggattat       480
     tgggaaggcg cccctgggca tgatattaaa attgaatatc ctcgctttga gtcggcctct       540
     ttgaagagcg ccgcagaaga attatcgctt tatttcggtg ggcgggcgac tctagggctg       600
     atcaaatcta gacagaagcc ttgggaccag caaaaggatt tattcccgga aaccggaggg       660
     tacatatctc taaatggccg ctgggatggg ttcggggtcg tacatgcaac cgacgaaatt       720
     ctgagtttga tttacgaagt tagttggtac ggggctggtg ccgcacaccc aaattcccat       780
     tttgaaacct ataatttttc cttacatgag cgtctgctac ttttgagtct cgacgatttt       840
     ttttgtgacc acacagctgc gttacaacgc atcagcgagc tgtgtatcgc agagttgtgt       900
     agggagtatt ggaggagaac cggcgaaaaa cccggtgaag atcaagttga atggttcacg       960
     aatggcgcgg cgggtactga ggaaaatctc agtgcattca cagttggcgc aaaccatttc      1020
     acatttctat ttgcaccata ccaagtgagc tcctatgcag atggaagatg gagcgtggaa      1080
     atttctttct atgaccttct ggaattccta aaaccagatg ggccccacac gtacgcagcg      1140
     gtaaggctag gtctggaata g                                                1161
//

If you have problems or comments...

PBIL Back to PBIL home page