(data stored in ACNUC7421 zone)

EMBL: CP000075.PE105

CP000075.PE105       Location/Qualifiers
FT   CDS_pept        complement(116991..117812)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Psyr_0105"
FT                   /product="Integrase, catalytic region"
FT                   /db_xref="EnsemblGenomes-Gn:Psyr_0105"
FT                   /db_xref="EnsemblGenomes-Tr:AAY35179"
FT                   /db_xref="GOA:Q4ZPT1"
FT                   /db_xref="InterPro:IPR001584"
FT                   /db_xref="InterPro:IPR012337"
FT                   /db_xref="InterPro:IPR025948"
FT                   /db_xref="InterPro:IPR036397"
FT                   /db_xref="UniProtKB/TrEMBL:Q4ZPT1"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAY35179.1"
FT                   /translation="MLGVSATGFHCHQARCAVNCPQRGLSDAALLVHIRAAHARSRGSY
FT                   GWPRIWHGLLADGVRVGKERVQKLMQLHGICGKGKRRFKVTTDSAHDLPISENLLDRQF
FT                   AVMEPDRAWVGDITYIPTDEGWLFLAVVVDLFSRQIVGWSMDERMKSSLVIDALRMAWF
FT                   KRHPHKASGLLFHSDRGSQYASFDFRHVLQGYGIVSSMSRRGNCWDNACSETVFGSLKV
FT                   ERLHGLKFKTRRAAKDEVINWLLWYNQERLHSTLHYVSPMQYEQNWQRQQP"
     gtgctgggcg tcagtgcgac cggctttcat tgccaccaag ctcgctgtgc agttaattgc        60
     cctcaacgag gtttaagcga cgcagcattg ctcgtccaca ttcgcgccgc tcatgcccgc       120
     agtcgtggca gctacggctg gcccaggatc tggcacggtt tgctggctga cggcgttcgc       180
     gtcggcaaag agcgtgtgca aaagctgatg cagcttcatg gtatttgcgg caagggcaaa       240
     cgacgtttca aagtgaccac tgatagcgct catgacttac ccatttcgga gaacctgctg       300
     gatcgccagt tcgccgtgat ggagcctgac agagcttggg tgggcgacat cacctacatc       360
     ccgacagatg agggctggct gtttctggcg gtagtggtag acctgttcag tcgccagatc       420
     gtgggctggt cgatggacga gcgcatgaaa agcagcctgg tgattgatgc gttgcgcatg       480
     gcctggttca agcgtcatcc acataaggcc tccggactgc tgtttcatag tgatcgcggg       540
     agccagtacg ccagctttga ttttcgtcat gtccttcagg gctacgggat tgtcagctcg       600
     atgagtcgac ggggcaattg ctgggataac gcgtgcagcg agaccgtgtt cggctcgttg       660
     aaggtggaac gtctgcatgg cttgaaattc aaaacccgac gcgctgccaa ggacgaggtc       720
     attaactggc tgctgtggta caaccaggag cgcctgcact cgacgcttca ttacgtaagt       780
     ccgatgcaat acgagcagaa ctggcaaagg caacaacctt ag                          822
//

If you have problems or comments...

PBIL Back to PBIL home page