(data stored in SCRATCH zone)

EMBL: CP000075.PE109

CP000075.PE109       Location/Qualifiers
FT   CDS_pept        120719..121144
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Psyr_0109"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Psyr_0109"
FT                   /db_xref="EnsemblGenomes-Tr:AAY35183"
FT                   /db_xref="InterPro:IPR010862"
FT                   /db_xref="UniProtKB/TrEMBL:Q500I9"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAY35183.1"
FT                   /translation="MNKESVDYELLNDIVKCIQEVFEFSKDAFETLSLATDINRELGIE
FT                   GDDANELMPEFFERFSINIDNYDPYRYFVPEGYDFFSFRRSKDRRGKIPITLGMLYMAA
FT                   REKVWNTQELESVKFSPAPLYNCTSEIPLEDYKNNDK"
     atgaataaag agagcgtgga ctatgagctg ctgaacgaca tagtcaagtg tattcaagaa        60
     gtgtttgaat tcagcaagga tgcatttgaa actctcagcc tggccactga tatcaaccgt       120
     gagctgggca ttgaagggga tgatgccaat gaactgatgc ccgagttctt tgagcgtttt       180
     tccataaata tagataacta tgatccctac aggtatttcg tacctgaggg atatgatttt       240
     ttttccttca ggcgaagcaa ggacaggcgc ggcaagattc ctataacttt gggtatgctt       300
     tatatggctg ctagagaaaa agtctggaac acacaggagt tagaaagcgt gaagtttagt       360
     cctgctccgc tttataactg cacgtctgag attcctttgg aagattataa gaataatgat       420
     aagtag                                                                  426
//

If you have problems or comments...

PBIL Back to PBIL home page