(data stored in ACNUC7421 zone)

EMBL: CP000075.PE111

CP000075.PE111       Location/Qualifiers
FT   CDS_pept        122362..122793
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Psyr_0111"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Psyr_0111"
FT                   /db_xref="EnsemblGenomes-Tr:AAY35185"
FT                   /db_xref="UniProtKB/TrEMBL:Q500I7"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAY35185.1"
FT                   /translation="MNTSSEEWISVSQHELNEVESKEQRGIKLQFMLSPADLPTAWRGY
FT                   NLNETTVVVEFKYLSSNESRLIESPSDVVSIEVGKNSKRIYRIMLDVLRNPPSGAIMIS
FT                   RATDALEHSHGLNKSNSEVILRFLTSKKSRPELLHMMGA"
     atgaatacat cgagcgaaga atggatttcc gtctcccagc atgagttaaa cgaagtcgaa        60
     tccaaagagc agcgtggcat aaagctacag ttcatgcttt ccccggccga tcttcccacc       120
     gcctggagag gttacaacct gaatgaaacg acggtagtcg tcgaattcaa atacctttcg       180
     agcaatgagt cgaggctaat tgagagtccg agcgatgttg tgagcataga ggtgggaaaa       240
     aacagtaagc gcatctacag aatcatgctg gatgttctga gaaaccctcc ctctggcgct       300
     atcatgattt cgagggcaac tgatgcattg gagcatagtc atggtctgaa caaaagcaac       360
     tccgaagtca tactacggtt tttgacctcc aaaaagtcgc gaccagaact gcttcacatg       420
     atgggggctt ag                                                           432
//

If you have problems or comments...

PBIL Back to PBIL home page