(data stored in ACNUC7421 zone)

EMBL: CP000075.PE113

CP000075.PE113       Location/Qualifiers
FT   CDS_pept        complement(123930..124664)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Psyr_0113"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Psyr_0113"
FT                   /db_xref="EnsemblGenomes-Tr:AAY35187"
FT                   /db_xref="InterPro:IPR024787"
FT                   /db_xref="UniProtKB/TrEMBL:Q500I5"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAY35187.1"
FT                   /translation="MDVVREILQNKVMRIKVYVWHHKAINHAPRLKMELISQEKIMQVL
FT                   DWAYERSVNGFSGLDSAEELAASYAGKDSSAYDQANSLIRWQNTKSATSGFITGLGGLI
FT                   TLPIALPANITSVLFVQIRMIAAIAHLGGYDVRDDKVKTLVFACLTANSAKEVLKDIGI
FT                   AVGNKLAMNAVKSISGKTLIEINKKVGFKLFTKFGEKGVINLGKAVPLLGGLIGGSFDA
FT                   YTTNTIGNVARDTFTPKEVAAV"
     atggatgtgg tgagggaaat tcttcaaaac aaggtaatgc ggataaaggt gtatgtgtgg        60
     catcataaag ccattaatca tgcaccgaga ctgaagatgg aactgataag tcaagaaaag       120
     ataatgcaag tcctcgactg ggcttacgag agatctgtga atggattctc tggtcttgat       180
     tccgctgagg agcttgcagc cagctacgcc gggaaagaca gctctgccta cgatcaagct       240
     aattcactga ttcgttggca aaacaccaag tccgcaactt caggctttat taccggcctg       300
     ggtggattga tcacgctgcc catcgcgttg cccgccaata tcacgagtgt gcttttcgta       360
     caaattcgca tgattgccgc tatcgcccat ttgggcggct acgacgtcag ggatgacaag       420
     gtaaagactt tggttttcgc ctgcctcaca gcaaactctg ccaaagaagt gttgaaagac       480
     atcggtattg ccgtcggtaa caagctggcg atgaacgccg tgaagtcgat ttccggaaaa       540
     acgcttatag aaataaacaa aaaggtgggc ttcaaactgt ttaccaagtt tggtgaaaaa       600
     ggcgttatca atcttggtaa agccgtgccc ctgctgggtg gcttgattgg tggaagtttc       660
     gatgcctaca cgaccaacac catcggtaat gtagcgcgcg atacatttac accaaaagaa       720
     gtcgcagcgg tataa                                                        735
//

If you have problems or comments...

PBIL Back to PBIL home page