(data stored in ACNUC7421 zone)

EMBL: CP000075.PE114

CP000075.PE114       Location/Qualifiers
FT   CDS_pept        125003..125455
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Psyr_0114"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Psyr_0114"
FT                   /db_xref="EnsemblGenomes-Tr:AAY35188"
FT                   /db_xref="UniProtKB/TrEMBL:Q500I4"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAY35188.1"
FT                   /translation="MLGRERAVRQFQKITSSMNPTSKVPPPETWVRVFPWSFTLKSFSK
FT                   VVAAAVCGLVLAGCTGTPMKTPHYDSSQYTVVGHSEASATGLMLFGLIPIRQNDRFVRA
FT                   QNSAIQAKGGDALINTQVQEKWFWAWVLNGYTTTVSGDVIKLKTAK"
     atgctcggtc gtgagcgcgc tgtgaggcaa tttcaaaaaa ttacctcaag catgaacccg        60
     acgagtaaag taccgccgcc cgagacgtgg gtccgggttt tcccatggag tttcaccttg       120
     aagtcattta gcaaagtcgt agccgcagca gtatgtggcc tggttctggc gggttgcacc       180
     ggcaccccta tgaaaactcc gcactatgac agcagccaat acacggtcgt cggtcacagt       240
     gaagcaagcg ccaccggcct aatgctgttc ggtctgatcc cgattcgtca gaacgaccgt       300
     tttgttcgtg cgcagaacag cgccattcag gccaagggtg gcgatgcgct gatcaatacc       360
     caagtgcagg aaaagtggtt ctgggcctgg gtcctgaacg gctacaccac caccgtttcg       420
     ggtgatgtga tcaagctgaa aaccgctaaa taa                                    453
//

If you have problems or comments...

PBIL Back to PBIL home page