(data stored in ACNUC7421 zone)

EMBL: CP000075.PE118

CP000075.PE118       Location/Qualifiers
FT   CDS_pept        complement(128434..129486)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Psyr_0118"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Psyr_0118"
FT                   /db_xref="EnsemblGenomes-Tr:AAY35192"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="InterPro:IPR030899"
FT                   /db_xref="UniProtKB/TrEMBL:Q500I0"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAY35192.1"
FT                   /translation="MTLLDAIQRENTGFETTLIKGIEPIRQFVLAISIYHLFDTKLFSL
FT                   LIKHPVASLDVACHELGMDKEKLLGLFRYLKNEGILLETIDGFSLSKEGHALAPFEGWY
FT                   VMLVGGYATTFLQMGERLQEGAGWATRDATKVGVGSCGISHFDAIPLTRSLMAKAPGTC
FT                   TKLLDLGCGNGRYLAEFCKALPQIQAWGAEPDRGGFEEAVDLIEKEGLSHRVHISHSGA
FT                   VEFLDSDFNFEPDFIVLGFVLHEILGQAGRPAVINFLKKIVHRFPAINLIIIEVDNQFD
FT                   NAGAMRHGLALAYYNPYYLLHCFTNQLLVQDADWLDIFAEAGLSLITRETTSDQVDSTG
FT                   LEIGYLLRRA"
     atgactctgc ttgacgctat ccaacgcgaa aacactggct ttgagacaac cctaattaag        60
     ggcatcgaac cgatccggca gttcgttctg gctatatcaa tttatcacct gttcgataca       120
     aaattatttt ccttgctgat taaacacccg gttgcctcgc tggatgtggc ctgtcatgag       180
     ctcgggatgg ataaagagaa actacttggt ttattcaggt acctgaagaa cgaagggatt       240
     cttctggaaa caatagacgg tttctcatta tcaaaagaag ggcacgcgct ggcacctttc       300
     gaaggctggt atgtgatgct ggtcggcggc tatgccacca cttttctaca aatgggcgaa       360
     cgccttcagg agggcgctgg ctgggccacc cgcgacgcaa ccaaggtcgg cgtaggtagc       420
     tgtggtatca gccacttcga cgcgatcccc ttgaccaggt ctttgatggc caaagctccc       480
     ggtacatgca caaaactgct ggacctgggt tgcggaaacg ggcgatacct cgccgaattc       540
     tgcaaggccc ttccgcagat acaggcttgg ggcgccgaac cggaccgcgg aggcttcgag       600
     gaggctgtag acctgatcga aaaagaaggt ctgtcgcatc gggttcacat cagccacagc       660
     ggggcagtcg aattcctgga ttcggatttt aatttcgagc ccgatttcat cgtgctgggt       720
     tttgtgctgc atgagatcct tggccaggcc ggtcgaccgg cagtgatcaa cttcctgaaa       780
     aagattgtcc accgtttccc cgcaatcaac ctgatcatta tcgaagtcga caaccaattc       840
     gacaatgccg gcgcaatgcg ccacggctta gcactcgctt attacaaccc ttactatctg       900
     ttgcattgct tcaccaatca attgttggtg caggacgctg attggctgga tattttcgcc       960
     gaggctggct tgtccctgat cacccgcgag acgacgtctg accaggttga ctcgaccggt      1020
     ctggaaatcg gctatctgct gcggagggca tga                                   1053
//

If you have problems or comments...

PBIL Back to PBIL home page