(data stored in ACNUC7421 zone)

EMBL: CP000075.PE126

CP000075.PE126       Location/Qualifiers
FT   CDS_pept        135970..136410
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Psyr_0126"
FT                   /product="Protein of unknown function DUF805"
FT                   /db_xref="EnsemblGenomes-Gn:Psyr_0126"
FT                   /db_xref="EnsemblGenomes-Tr:AAY35199"
FT                   /db_xref="GOA:Q500H3"
FT                   /db_xref="InterPro:IPR008523"
FT                   /db_xref="UniProtKB/TrEMBL:Q500H3"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAY35199.1"
FT                   /translation="MVFCRGCAKEISDDAGTCPHCGAPQLVISPASASTDNPPAWSWYT
FT                   DVLKKYAVFTGRARRKEYWMFFLFNILISIVLGFIGGLIGDGGIIANLYSLAVLVPGVA
FT                   VGVRRLHDTDRSGWWLLVPIANLVFLIQEGHPGPNRFGPSPK"
     atggtatttt gtcgtggttg tgcaaaggaa atcagtgatg acgctggtac gtgtccgcac        60
     tgcggggctc cgcagctggt tatttcgcca gccagtgcga gcaccgataa cccgcctgcg       120
     tggagctggt atacagacgt tctgaaaaaa tatgcggtgt tcacgggcag agcacgcaga       180
     aaagaatact ggatgttttt tctgttcaac atcttgatct cgattgtcct cggctttatc       240
     ggcgggctga taggtgatgg cggcattatc gctaaccttt actccctggc cgtgctggtc       300
     ccaggtgtcg cggtgggtgt tcgcaggttg cacgacacgg atcgcagtgg ctggtggctg       360
     ctggtaccga ttgccaacct tgtgttcctg attcaggaag gtcatccagg accgaaccgt       420
     tttgggccaa gtcctaagta a                                                 441
//

If you have problems or comments...

PBIL Back to PBIL home page