(data stored in ACNUC7421 zone)

EMBL: CP000075.PE130

CP000075.PE130       Location/Qualifiers
FT   CDS_pept        complement(138083..138991)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Psyr_0130"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Psyr_0130"
FT                   /db_xref="EnsemblGenomes-Tr:AAY35203"
FT                   /db_xref="GOA:Q500G9"
FT                   /db_xref="UniProtKB/TrEMBL:Q500G9"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAY35203.1"
FT                   /translation="MQGKQTMSIHQLRKDVEEHFQRFERAPFKEAWRRRDARICLIWMI
FT                   AWILALSATLIFLPWTKLADYMPALVPVLLISMICAVRLAEVYELVRADQMGAGPLTTP
FT                   LERSQLRQQWFCTRYSCSSAELVDKARVMRHLWEERQELKRLASNDTMGPRIAAFFRLP
FT                   DPARFIGTLFAIAAIFTTMITLGSNIDAIFAAVQDWRTIGFNILLGTFLCAEIVWLWIM
FT                   VTGMISEIGPSLLEQLGLLPMSSRRVYRYLLAVHGASEPVTPVPNATRGLLKMSSLFFM
FT                   PVGEVWAKVRTRFTARSAAMA"
     atgcaaggga agcaaacgat gagcatccac cagttgcgta aggatgtaga agaacacttt        60
     cagcgatttg agcgtgcgcc tttcaaagaa gcttggcgtc ggcgtgatgc tcgtatctgt       120
     ctgatctgga tgatcgcatg gatattggca ctctccgcaa cgctgatatt tttgccttgg       180
     accaagctgg ctgactacat gcctgcgttg gttcctgtgc ttctgatatc catgatctgc       240
     gcagttcgat tggctgaggt ctatgagctg gttcgcgcag atcaaatggg cgctggaccg       300
     ctcacgacac ctttggagcg ttcgcaattg cggcaacaat ggttttgcac ccgttatagc       360
     tgtagttctg cagagctcgt cgataaggca agggtgatga gacacctgtg ggaagagcgt       420
     caagaactca agcggctggc cagcaacgat acgatgggac cacgcatcgc agctttcttt       480
     cgtctcccag accctgcccg attcatcgga acgctgtttg ccatcgccgc gatctttaca       540
     acaatgatca ccttgggtag caacatcgac gccatcttcg ccgccgtaca agactggcga       600
     acaataggct tcaatatcct actcggcacg ttcttgtgcg ccgaaatcgt gtggctttgg       660
     atcatggtca ccggcatgat cagcgagata ggcccttcat tgcttgaaca gcttggactg       720
     ctgcccatga gcagccgtcg agtttatcgg tatttgcttg cagtacatgg tgcgagtgag       780
     cctgtaacac cggttcccaa cgcaacgcgt ggattactga agatgagctc tttgttcttt       840
     atgcccgttg gcgaggtgtg ggcgaaggtg cggacgcgtt ttacggcgcg ctccgcagcc       900
     atggcctga                                                               909
//

If you have problems or comments...

PBIL Back to PBIL home page