(data stored in ACNUC7421 zone)

EMBL: CP000075.PE132

CP000075.PE132       Location/Qualifiers
FT   CDS_pept        complement(140362..140610)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Psyr_0132"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Psyr_0132"
FT                   /db_xref="EnsemblGenomes-Tr:AAY35205"
FT                   /db_xref="UniProtKB/TrEMBL:Q500G7"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAY35205.1"
FT                   /translation="MTTDHILTDSVPKEDPASPQLGQYDREADPVLAMNANRPGVGPKK
FT                   GDELKKRTEHDETYDEGEPEVDDADSVSDEGGGALPG"
     atgacaaccg atcacatact cacagacagc gtgcccaaag aagaccccgc cagcccgcaa        60
     ctcggccagt acgaccgcga agcagacccg gtcctcgcca tgaacgcgaa cagacccggc       120
     gtcggtccga aaaaaggcga cgagttgaag aagcgtacgg aacacgacga gacttacgat       180
     gaaggtgagc cggaagtgga cgacgccgac agcgtctcgg atgagggcgg cggcgctctg       240
     ccgggctga                                                               249
//

If you have problems or comments...

PBIL Back to PBIL home page