(data stored in ACNUC7421 zone)

EMBL: CP000075.PE135

CP000075.PE135       Location/Qualifiers
FT   CDS_pept        144401..145225
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Psyr_0135"
FT                   /product="outer membrane transport energization protein
FT                   TonB"
FT                   /note="TC 2.C.1.1.1"
FT                   /db_xref="EnsemblGenomes-Gn:Psyr_0135"
FT                   /db_xref="EnsemblGenomes-Tr:AAY35208"
FT                   /db_xref="GOA:Q500G4"
FT                   /db_xref="InterPro:IPR006260"
FT                   /db_xref="InterPro:IPR037682"
FT                   /db_xref="UniProtKB/TrEMBL:Q500G4"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAY35208.1"
FT                   /translation="MNDAVIMKAVPSPSPDDTSTAWQGIPFSANTSRPGGLNKPQVMVL
FT                   IAASVLIHGVIWWYMQTAQPDVPEVAPQVPEMTIELTSPTPPAPEPPPPEPPPPPPPPP
FT                   PPPEPEQPVEDPDAVEPPPKPVEKPKVEKPKPVKKVEPVKKPTPPAPTPAAAPSPPAPP
FT                   TPAPAPPAPAAPPAPVKESAAVSGLASLGNPPPEYPGLALRRSWEGRVILRIKVLPNGR
FT                   AGAVEVTKSSGKPVLDEAAVEAVRNWKFIPAKRGDTPIEGFATQTIDFKLPE"
     atgaatgatg cggtcataat gaaagcggtc ccctctccct cgcccgatga cacttcgacg        60
     gcgtggcagg gtattccttt cagcgccaat acgtcacgcc cgggcggcct taacaagccg       120
     caagtaatgg tgttgattgc tgcgtcggta cttattcatg gtgtgatctg gtggtacatg       180
     caaacggccc agccagacgt gccggaagtt gcgccacaag ttccggaaat gaccattgaa       240
     ctgaccagcc cgacaccacc cgcaccggaa ccgccgccgc ccgagccacc acctccgccg       300
     ccgcctccac cgcctccccc cgaaccggaa caaccggtcg aggacccgga cgcggtcgaa       360
     ccgccgccca aaccggtgga aaaacccaag gtcgagaagc ccaagccggt caagaaagtc       420
     gaaccggtga aaaagcctac gccgcctgcg ccaacgcctg ccgccgcacc cagcccgccc       480
     gcgccgccaa cacctgcgcc cgcgccgccg gcacctgctg cgccaccggc tccggtcaag       540
     gaaagcgctg cggtatccgg gctcgccagc ctgggcaatc caccgccgga atacccgggg       600
     ctggccttgc gacgcagttg ggaaggtcgc gtgattctgc gcatcaaggt gctgcccaat       660
     ggccgcgccg gggctgtcga ggtgaccaaa tccagcggca aaccggtact ggacgaagcg       720
     gccgtggagg ctgtgcgcaa ctggaagttc ataccggcca aacgcggtga cacgccgata       780
     gaaggcttcg cgacgcagac catcgacttc aagttgccgg aatga                       825
//

If you have problems or comments...

PBIL Back to PBIL home page