(data stored in ACNUC7421 zone)

EMBL: CP000075.PE137

CP000075.PE137       Location/Qualifiers
FT   CDS_pept        145986..146387
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Psyr_0137"
FT                   /product="outer membrane transport energization protein
FT                   ExbD"
FT                   /note="TC 2.C.1.1.1"
FT                   /db_xref="EnsemblGenomes-Gn:Psyr_0137"
FT                   /db_xref="EnsemblGenomes-Tr:AAY35210"
FT                   /db_xref="GOA:Q500G2"
FT                   /db_xref="InterPro:IPR003400"
FT                   /db_xref="UniProtKB/TrEMBL:Q500G2"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAY35210.1"
FT                   /translation="MSFSTQDSDEVLSEMNVTPLVDVMLVLLVVFIVTTPLMTNAIKVN
FT                   LPKTDAVAPAEKKNPVVVSVDQDGKFYLAKSEIAPELLEKSLQDEKAKDPEIRVQLQAD
FT                   TAVNYGQVAKAMASIERSGITKISVMTAK"
     atgtctttct ccactcagga cagcgatgaa gtgctcagcg aaatgaacgt cacgccgctg        60
     gtcgacgtga tgctcgtgct gctggtggtg ttcatcgtca ccacgccgct gatgaccaac       120
     gcgatcaagg tcaacctgcc caagaccgac gcggtcgctc ccgccgagaa gaaaaacccg       180
     gtggtggtca gcgtcgatca ggacggcaag ttctacctcg ccaaatcgga aatcgccccg       240
     gagctgctgg aaaaaagcct gcaggacgaa aaggccaagg acccggaaat ccgcgtccag       300
     ttgcaggccg acaccgccgt gaattatggc caggtggcca aggccatggc ctccatcgaa       360
     cgctccggca ttacgaagat atccgtcatg acagcgaaat ga                          402
//

If you have problems or comments...

PBIL Back to PBIL home page