(data stored in ACNUC7421 zone)

EMBL: CP000075.PE141

CP000075.PE141       Location/Qualifiers
FT   CDS_pept        152409..153431
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Psyr_0141"
FT                   /product="Binding-protein-dependent transport systems inner
FT                   membrane component"
FT                   /db_xref="EnsemblGenomes-Gn:Psyr_0141"
FT                   /db_xref="EnsemblGenomes-Tr:AAY35214"
FT                   /db_xref="GOA:Q500F8"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:Q500F8"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAY35214.1"
FT                   /translation="MFEFSPQTRRRFDLFKANRRGWWSLWIFIGLLLVCLCGELIANDK
FT                   PLLIRYDGQLYYPVLHTYMETDFGGELPFEPDYASDYVRKLIAAKNGWMLFAPIPFSYD
FT                   TINYDLDAPSPSPPDHINWLGTDEQARDVLARVLFGARISILFALLLTAISTVIGVCAG
FT                   AIQGYYGGMTDLIGQRIQEIWSGLPVLYLLIILSGFVSPSFWWLLGIMALFSWLSLVDV
FT                   VRAEFLRGRNLEYVKAARALGLTDAALMWRHILPNAMTSTLTYLPFIITGAIATLTALD
FT                   FLGFGMPAGSASLGELIGEAKRNLQAPWLGLTAFVVLALILSLLVFIGEACRDAFDPRS
FT                   "
     atgttcgagt tctctcccca gacccggcgc cgcttcgacc tgttcaaggc caaccgtcgc        60
     ggttggtggt cgctgtggat cttcatcggc ctgctgctgg tgtgcctgtg cggcgaactg       120
     atcgccaacg acaagccgct gctgatccgc tacgacgggc agttgtatta cccggtgttg       180
     cacacctaca tggaaaccga tttcggcggc gagctgccct tcgagccgga ctatgccagc       240
     gactacgtgc gcaagctgat cgcggcaaaa aacggctgga tgctgttcgc gccgatcccg       300
     ttcagctacg acaccatcaa ctacgacctg gacgcgccat cgcccagtcc gccggaccac       360
     atcaattggc tgggcaccga cgagcaggcc cgtgatgtgc tggcgcgtgt gctgttcggc       420
     gcgcggattt ccattctgtt cgcgctgctg ctgaccgcga tcagcacggt gatcggcgtg       480
     tgtgccgggg cgattcaggg ttactacggc ggcatgaccg acctgatcgg ccagcgcatt       540
     caggagatct ggtcggggct gccggtgctg tacctgctga tcattctgtc cggctttgtg       600
     tcgccgagtt tctggtggct gctggggatc atggcgctgt tctcctggct gtcgctggtg       660
     gacgtggtgc gtgccgagtt cctgcgcggg cgcaacctgg aatacgtcaa ggccgcccgc       720
     gcactgggcc tgaccgatgc cgcgctgatg tggcggcaca tcctgcccaa cgcgatgacc       780
     agcaccctga cttacctgcc gttcatcatc accggcgcca tcgccaccct cactgcgctg       840
     gattttctcg gcttcggcat gccggcgggc agtgcgtcgc tgggcgagct gatcggcgag       900
     gccaagcgca atctgcaagc gccctggctg gggctgacgg cgttcgtggt gctggccctg       960
     attctttctc tgctggtgtt catcggcgaa gcctgccgcg acgcgttcga tcctcggagc      1020
     tga                                                                    1023
//

If you have problems or comments...

PBIL Back to PBIL home page