(data stored in ACNUC7421 zone)

EMBL: CP000075.PE145

CP000075.PE145       Location/Qualifiers
FT   CDS_pept        complement(157566..158240)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Psyr_0145"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Psyr_0145"
FT                   /db_xref="EnsemblGenomes-Tr:AAY35218"
FT                   /db_xref="InterPro:IPR023214"
FT                   /db_xref="InterPro:IPR036412"
FT                   /db_xref="UniProtKB/TrEMBL:Q500F4"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAY35218.1"
FT                   /translation="METLPAMGLIDYRALLIDCDEVLVDRDSGVWSALQPLLDNSLSTP
FT                   AKDQVLIEFNDVVRTLYPRFDELGFSGLLCFAHRQLAERLGIKASWEEGMTFARSVPNW
FT                   TLFEDAPGAMLYLRKFYRLLVYADRDMQDRGLLCERLGLEPDSLLSLTTHPLDDTGWLA
FT                   DMDLEPRETLFVSRPPASALASGGLCLIRRGREQHSQPCTADICINSMADLVAQHQLSL
FT                   RR"
     atggagacgt tgcctgccat ggggcttatt gattaccgcg cactgctgat cgattgtgat        60
     gaagtgctgg tggaccgtga ttcgggggtc tggtcggcgt tgcagccatt gctggacaac       120
     agcctgagca cgccggcgaa agaccaggtg ctgatcgaat tcaatgacgt ggtccgcacc       180
     ttgtacccac gctttgacga actgggcttc agcggcctgc tgtgcttcgc gcaccgccag       240
     ctggccgaac gcctgggcat caaggccagt tgggaagagg gcatgacctt cgcccgctcc       300
     gtgccgaact ggacgctgtt cgaagatgcg cccggtgcga tgctctacct gcgcaagttc       360
     tatcgattgc tggtgtatgc cgaccgcgac atgcaggatc gcggccttct gtgcgagcga       420
     ctggggctgg agcccgacag cctgctgtca ctgaccaccc acccgctgga cgacacgggc       480
     tggcttgccg atatggatct ggagccgcgc gaaaccctgt ttgtctcccg ccccccggcc       540
     tcggcgctgg cgagcggtgg gttgtgcctg atccggcgtg gtcgggaaca gcacagccag       600
     ccctgcacgg cggatatctg tatcaacagc atggctgatc tggtcgctca gcatcagctg       660
     tctttacggc gctga                                                        675
//

If you have problems or comments...

PBIL Back to PBIL home page