(data stored in ACNUC7421 zone)

EMBL: CP000075.PE147

CP000075.PE147       Location/Qualifiers
FT   CDS_pept        159893..160822
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Psyr_0147"
FT                   /product="D-isomer specific 2-hydroxyacid dehydrogenase,
FT                   NAD-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:Psyr_0147"
FT                   /db_xref="EnsemblGenomes-Tr:AAY35220"
FT                   /db_xref="GOA:Q500F2"
FT                   /db_xref="InterPro:IPR006140"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:Q500F2"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAY35220.1"
FT                   /translation="MPALLYKADPARAERWRVLFAEHAPDIEWRVWPDIGDPADIHYLG
FT                   AWLAPDDLQELLPNLKVLFALSAGVDQLDLSRIPKSLPVVRLLDPGISHAMCEYATFAV
FT                   LSLHREMLRYRQQQVEGVWKAHPLIPANQRRVGVMGLGLQAQHILSSLKPFGFELSGWA
FT                   RSEHRIDAVQCYAGEEQLDAFLGQCDILLCVLPLTGQTEGILNRRLFEQLPKGAALINM
FT                   GRGGHLVEAELIEALDSGQLSAAVLDVLQQEPAAADHPFWTHPKILLTPHVAAMTQPES
FT                   AFPGLLDNIRRFERGEAMQGQVDRGQGY"
     atgcccgccc tgctctacaa agccgatccc gcacgtgccg aacgctggcg cgtcctgttt        60
     gccgagcacg cgccggacat cgagtggcgg gtatggccgg acatcggcga cccggccgac       120
     atccactatc tgggcgcctg gcttgcgccc gacgatctgc aggaactgct gcccaacctc       180
     aaagtgctgt tcgccctgtc ggcgggtgtg gaccagttgg acctgagccg tattccaaaa       240
     tcgctgccgg tggtgcgtct gctggacccc ggcatcagtc acgcgatgtg tgagtacgca       300
     acctttgccg tgctgagcct gcaccgggaa atgctgcgtt atcggcagca gcaagttgaa       360
     ggcgtctgga aagctcaccc gctgataccg gcgaaccaac gccgagtcgg cgtgatgggg       420
     ctggggttgc aggcgcagca tattctgtcg agcctcaaac cgttcggttt cgagctgtcg       480
     ggctgggcgc gcagcgagca tcgaatcgac gctgtgcagt gctatgccgg agaagagcaa       540
     ctggacgcat ttctggggca gtgcgacatt ttgctgtgtg tgctgccgct gaccgggcag       600
     accgaaggca tcctcaatcg tcggcttttc gaacaattgc ccaagggcgc cgcgctgatc       660
     aatatgggcc gtggcgggca tctggtggaa gcggagctga ttgaagcgct ggacagcggt       720
     caactcagcg ctgcagtgct ggatgtgctg cagcaggaac cggcagcagc cgaccatccg       780
     ttctggacac acccgaagat cctgctgacc ccgcatgtgg cggccatgac ccagccggaa       840
     agcgcctttc ctggcctgct cgataacatc cgccgttttg agcgtggtga agcgatgcaa       900
     ggacaggtgg atcgcggcca gggttattaa                                        930
//

If you have problems or comments...

PBIL Back to PBIL home page