(data stored in ACNUC7421 zone)

EMBL: CP000075.PE15

CP000075.PE15        Location/Qualifiers
FT   CDS_pept        complement(16812..19175)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Psyr_0015"
FT                   /product="Oxidoreductase alpha (molybdopterin) subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Psyr_0015"
FT                   /db_xref="EnsemblGenomes-Tr:AAY35089"
FT                   /db_xref="GOA:Q500T3"
FT                   /db_xref="InterPro:IPR006656"
FT                   /db_xref="InterPro:IPR006657"
FT                   /db_xref="InterPro:IPR009010"
FT                   /db_xref="InterPro:IPR010046"
FT                   /db_xref="InterPro:IPR037951"
FT                   /db_xref="InterPro:IPR041953"
FT                   /db_xref="UniProtKB/TrEMBL:Q500T3"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAY35089.1"
FT                   /translation="MSESENSQAPLQGSQTDGTPAGGWAALSAVNKHLLHQHVLIKGNR
FT                   TLMSMNKPGGFDCPSCSWPDPKKPHTFEYCENGAKALAWESTKKRVTPEFFARHTVSEL
FT                   ATWSDHELEAEGRITEPMRYDAATDKYLPVTWDEAFAEIGEELRNLSDPWKLELYTSGR
FT                   TSNEAAFLYQLFGRMYGMANFPDCSNMCHETTTAALPESIGVGKGTTTLEDFESADAIF
FT                   IIGQNPGTNSPRMMSELHAAARRGASIISFNPLRERALVRFAAPQDPRDMLSLHGVEIS
FT                   SQYHQVRIGGDMIALQGVCKAVIEADDVAQREHLPRVLDVAFIEEHTHGFEQYADYCRQ
FT                   LPWDIIERHSGLTRQAIEEVAAVYKRSKGVICCWGMGITQHKRGGDAMQQIINLLLLRG
FT                   NIGKLGAGACPVRGHSNVQGDRTMGIYEKAGEPFLASMSKVFGFEASRKKGHAVAETCE
FT                   ALLRGEVEALISMGGNFFRAIPDTDVICPTVSRLKMTVLVNTKLNRSATVHGQKAFLLP
FT                   CVARSERDLQNGVAQTITVEDSMSMVHGSTGMLEPASKHLISEVAIIAGIAKATLAPNP
FT                   KVDWDSYVGDYSRIRDKIEEVLPEQFYDFNQRILEPGGFRLPNAASERKWDTESGKANF
FT                   LFPEGIYDEDDTPPGAEHLQLMTIRSHDQFNTTVYSNDDRYRDIFGDRMVVMLNPQDIE
FT                   RLGLKAGDYIEFQTALDPTTARRAAGFKVIPYDVPQGCCAAYYPETNGLLPLANRDKHG
FT                   NTPAAKSIPVNLVRMSSEGTQVALERRGLIAAAS"
     atgtccgaat cggaaaactc ccaggccccg cttcagggat cacagaccga cggcacgccg        60
     gcaggtggct gggccgcgct cagtgcggtc aacaagcacc tgttgcacca gcatgtgctg       120
     atcaagggca accgcacgct gatgtccatg aacaagcctg gcggcttcga ctgccccagc       180
     tgctcctggc cggacccgaa gaagccgcac acctttgaat actgcgagaa cggtgccaag       240
     gccctggcct gggaatcgac caagaaacgc gtgactccag agttcttcgc ccggcatacg       300
     gtcagcgaac tggccacctg gagcgaccac gagctggaag cagaaggccg tattaccgag       360
     ccgatgcgct acgacgccgc cactgacaaa tacctgcccg tcacctggga cgaggcgttc       420
     gccgagatcg gcgaagaact gcgcaacctg agcgacccgt ggaagctgga gctgtacacc       480
     tcagggcgca catcgaacga agccgccttt ctgtatcagc tgtttggccg gatgtacggc       540
     atggccaact tccctgactg ctcgaacatg tgccatgaga ccaccaccgc ggcgctgccc       600
     gagtcgatcg gggtcggcaa aggcaccacg acgctggagg atttcgagag cgccgacgcg       660
     attttcatca tcggccagaa ccccgggacc aacagcccgc gcatgatgtc cgagctgcac       720
     gccgccgcgc gccggggcgc gagcatcatc tcgttcaacc cgctgcggga gagggcgctg       780
     gtacgttttg cggcgccgca ggacccgcgc gacatgctca gtctgcatgg ggtggaaatc       840
     agctcgcagt accatcaggt caggatcggc ggcgacatga tcgccctgca aggcgtttgc       900
     aaggccgtga tcgaagccga cgacgtggcg cagcgtgaac acctgccacg tgtactcgat       960
     gtggcgttca ttgaagaaca cacccatggc ttcgagcagt acgccgatta ctgccgacag      1020
     ttgccctggg acatcatcga gcgccattcg ggcctgacgc gtcaggccat cgaagaggtg      1080
     gcggcggtct ataagcgctc gaagggggtc atctgctgct ggggaatggg catcactcag      1140
     cacaagcgcg gcggtgacgc catgcagcag atcatcaacc tgctgctgtt acgcggcaac      1200
     atcggcaagc ttggtgcggg ggcgtgtccg gtgcgtgggc attccaacgt acagggcgac      1260
     aggacgatgg gcatctacga aaaggccggc gaaccgtttc tggccagcat gagcaaggtg      1320
     ttcggtttcg aggcgtccag aaaaaaaggt cacgctgtgg ccgagacctg cgaagccctg      1380
     ttgcgtggcg aggtggaagc gctgatttcc atgggcggta attttttccg cgccattccg      1440
     gacaccgatg tgatctgccc gaccgtcagc cgcctgaaaa tgacggtgct ggtcaacacc      1500
     aagctcaacc gcagcgcgac agtccatggt cagaaggcct ttctgctgcc gtgcgtggca      1560
     cgttcggagc gcgacctgca gaacggtgtg gcgcaaacca ttacggtgga ggactcgatg      1620
     tcgatggtgc acggctcgac cggcatgctt gagcctgcgt cgaaacatct gatttccgaa      1680
     gtggcgatca ttgccggtat cgccaaagcg acgcttgcgc ccaatcccaa ggtggactgg      1740
     gacagctatg tgggcgacta ctcaaggatt cgcgacaaga tcgaagaagt actgcccgag      1800
     cagttttatg acttcaatca gcgcatcctc gaacccggag gtttccgctt gcccaatgcc      1860
     gccagtgagc gcaagtggga caccgagtcg ggcaaggcca acttcctctt tcccgaaggt      1920
     atctacgacg aagacgacac gccgccgggc gccgagcatc tgcagttgat gacgatccgt      1980
     agccatgacc agttcaacac cacggtgtat tccaacgatg accgctatcg ggacatcttt      2040
     ggcgaccgca tggtggtgat gctcaacccg caggacatcg aacgcctggg gctgaaggcc      2100
     ggggactaca tcgagtttca gacggcgctc gacccgacca ccgcgcggcg tgcagcgggt      2160
     ttcaaggtca tcccctacga cgtgccgcag ggttgctgcg ccgcgtacta cccggagacc      2220
     aacggcctgc taccactggc caatcgggat aaacacggca atacccctgc ggccaaatcc      2280
     atcccggtga acctggtgcg gatgagttca gagggtactc aggtggcgct ggagcgacgc      2340
     gggttgattg cggcggccag ttga                                             2364
//

If you have problems or comments...

PBIL Back to PBIL home page