(data stored in ACNUC7421 zone)

EMBL: CP000075.PE153

CP000075.PE153       Location/Qualifiers
FT   CDS_pept        complement(166469..166780)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Psyr_0153"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Psyr_0153"
FT                   /db_xref="EnsemblGenomes-Tr:AAY35226"
FT                   /db_xref="GOA:Q500E6"
FT                   /db_xref="InterPro:IPR036010"
FT                   /db_xref="InterPro:IPR042204"
FT                   /db_xref="UniProtKB/TrEMBL:Q500E6"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAY35226.1"
FT                   /translation="MNGRFVRLGERDRPVVSLMVDGAPIEALQGDTLMVALLTRKATLR
FT                   QSEFDPGRRAGFCLMGACQDCWVWSRSGERLRACSNEVRDGLDIVTTQPEAKWPLLHG"
     atgaatggtc gctttgtgag gctgggcgag cgcgatcgcc cggtcgtaag cctgatggtc        60
     gatggcgcgc ccatcgaggc attgcagggc gataccctga tggtggcgtt gctgacccgc       120
     aaggcgacat tacgccagtc cgagttcgac ccgggacgcc gtgcaggttt ctgcctgatg       180
     ggcgcctgtc aggattgctg ggtctggagc cgcagcggcg agcggctgcg cgcctgctcc       240
     aacgaagtcc gcgacggact cgacatcgtc accacccaac cggaggcgaa atggccactt       300
     cttcacggtt ag                                                           312
//

If you have problems or comments...

PBIL Back to PBIL home page