(data stored in ACNUC7421 zone)

EMBL: CP000075.PE155

CP000075.PE155       Location/Qualifiers
FT   CDS_pept        complement(168620..169498)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Psyr_0155"
FT                   /product="Binding-protein-dependent transport systems inner
FT                   membrane component"
FT                   /db_xref="EnsemblGenomes-Gn:Psyr_0155"
FT                   /db_xref="EnsemblGenomes-Tr:AAY35228"
FT                   /db_xref="GOA:Q500E4"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:Q500E4"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAY35228.1"
FT                   /translation="MTQFIAKSTPAAPQPVLRKKASLPTSWLGLLGATVCFIWLMVALF
FT                   GPWLAPHPVGEVVSDNMFENMSAAYPFGTDYLGRDMLSRVLVGARFTVGLALISAVLAS
FT                   GIGTLCALLSVVAPKWLDEIISRLMDAFISIPSKMLALIMVSAFGSSEVLLICTAVLSY
FT                   TPGAFRIARSLAVNIEALEYVQVARTRGEGRIYIACREILPNMLNPVMTDLGLRFGFIV
FT                   LLLSGMSFLGLGVQPPDADLGSLVRENIGGLSQGAPAIVIPALAIGTLTIGVNLLIDRL
FT                   ASRRGRRSGGH"
     atgactcaat tcattgcgaa atcgacgccc gcagcgccgc aaccggtgct tcgcaaaaaa        60
     gcgtcccttc cgacctcatg gcttggcctg ctgggcgcta cggtgtgctt catctggctg       120
     atggtcgccc tgttcggccc ctggctggca ccgcatccgg tgggcgaagt ggtctccgac       180
     aacatgttcg aaaacatgag cgcagcctat cccttcggta cggactacct gggccgcgac       240
     atgctcagcc gcgtgctggt cggcgcgcgc ttcaccgtcg gcctggcatt gatttctgcc       300
     gtgctggcca gcggcatcgg caccctgtgt gcgctgctgt cggtggtcgc gccaaaatgg       360
     ctggacgaaa tcatcagccg cctgatggac gcgttcatct cgatccccag caaaatgctg       420
     gcgctgatca tggtctcggc gttcggctcg tccgaggtgc tgctgatctg cacggcggtg       480
     ctcagctaca ccccaggcgc gtttcgcatc gcgcgcagtc tggcggtgaa catcgaggcg       540
     ctggagtacg tgcaggtagc gcgcacacgc ggcgagggtc gtatctacat tgcctgccgg       600
     gaaatcctgc cgaacatgct caacccggtc atgaccgacc tgggcctgcg tttcggcttc       660
     atcgtcctgc tgctcagcgg catgagcttt ctggggctcg gtgtacaacc gcctgacgcc       720
     gaccttggct cgctggtccg cgagaacatc ggcgggctca gccagggcgc gccggccatc       780
     gtgatcccgg ccctggccat cggcaccctg accatcggcg tgaacctgct catcgaccgg       840
     ctggcctcgc ggcgcggtcg tcgttcggga gggcattga                              879
//

If you have problems or comments...

PBIL Back to PBIL home page