(data stored in SCRATCH zone)

EMBL: CP000075.PE167

CP000075.PE167       Location/Qualifiers
FT   CDS_pept        181423..181845
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Psyr_0167"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Psyr_0167"
FT                   /db_xref="EnsemblGenomes-Tr:AAY35240"
FT                   /db_xref="GOA:Q500D2"
FT                   /db_xref="UniProtKB/TrEMBL:Q500D2"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAY35240.1"
FT                   /translation="MYFRSFFFFIFMLIALVVYSIAFNLFDNTDCERYNHTEALDGGAK
FT                   SFGSKGFVITVCGAGVNNSLFNGDGMERVRLTIFDNQGELLARRYYKVFWDGQPGHEPL
FT                   KVSKKSIIYQDDKEQKDHVITMPPTRLEWIRARLPL"
     atgtatttcc gctctttttt cttctttatt tttatgttga ttgctttggt tgtttattcc        60
     attgctttca acctgttcga caacactgat tgtgaacgct ataaccacac tgaggcatta       120
     gatggaggtg caaagagttt tggcagtaaa ggttttgtaa taactgtttg cggagccggg       180
     gtgaacaata gtctttttaa tggagatggt atggagaggg tccggctgac tatcttcgac       240
     aatcaaggcg agctgttagc caggagatac tataaagttt tttgggacgg ccagccgggg       300
     catgagccgc ttaaggtctc caaaaaaagt attatctatc aagatgataa agagcagaaa       360
     gatcatgtga tcactatgcc tcccacacgc ttggaatgga ttagggcaag gcttcccctg       420
     taa                                                                     423
//

If you have problems or comments...

PBIL Back to PBIL home page