(data stored in ACNUC7421 zone)

EMBL: CP000075.PE169

CP000075.PE169       Location/Qualifiers
FT   CDS_pept        complement(183940..184842)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Psyr_0169"
FT                   /product="Hsp33 protein"
FT                   /db_xref="EnsemblGenomes-Gn:Psyr_0169"
FT                   /db_xref="EnsemblGenomes-Tr:AAY35242"
FT                   /db_xref="GOA:Q500D0"
FT                   /db_xref="InterPro:IPR000397"
FT                   /db_xref="InterPro:IPR016153"
FT                   /db_xref="InterPro:IPR016154"
FT                   /db_xref="InterPro:IPR023212"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q500D0"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAY35242.1"
FT                   /translation="MHDFPNIDFTQRFIFDESDVRGELVALERSYAEVLAKHPYPEPVA
FT                   QLLGELMAAAALLVGTLKFDGLLILQARSSGAVPLLMVECSSERELRGIARYDEALVTA
FT                   GAGLQDLMPDGSLALTIDPNKGKRYQGIVALDGVDLSESLSNYFVMSEQLGTRFWLKAD
FT                   GHRARGLLLQQLPIAQITDPEERDASWEHVITLANTLTAEEMLGLDNQTILHRLYHEDP
FT                   VRLFDEQPICFRCSCSRERSANALASLGLEDAQQLVIEHNGTIEIDCQFCNQRYLFDAT
FT                   DVAQLFAGGGVDSPSDTRH"
     atgcatgatt tcccgaacat cgatttcacc caacgcttca tcttcgacga aagcgacgtt        60
     cgcggagaac tggtcgccct ggagcgcagc tacgccgaag tgctcgccaa gcatccctac       120
     ccggagccgg tcgcgcagtt gcttggcgaa ctgatggcgg ctgccgcgct gctcgtcggc       180
     accctcaaat tcgacggcct gctgatcctg caggcacgct ccagcggcgc agtgccgttg       240
     ctgatggtcg agtgctccag cgagcgtgaa ctgcgtggca ttgcccgtta tgacgaggca       300
     ctggtcacag caggcgcagg tctgcaggac ctgatgcccg atggctcgct ggcattgacc       360
     atcgacccga acaagggcaa gcgctatcag ggcatcgttg ccctcgacgg cgtcgacctg       420
     tcggaaagcc tctccaacta tttcgtgatg tccgaacagc tgggcacgcg tttctggctc       480
     aaggccgacg gtcatcgcgc ccgcggtctg ttgctgcaac agctgcccat cgcgcagatc       540
     accgatccgg aagagcgcga cgccagctgg gagcacgtca tcaccctggc caacaccctc       600
     acggccgagg aaatgctcgg gctggacaac cagaccatcc tgcatcgcct gtatcacgaa       660
     gacccggttc gcctgttcga cgagcagccc atctgctttc gctgcagttg ctcgcgtgag       720
     cgctcggcca atgcgctggc cagccttggg ctggaggacg cgcagcaact ggttatcgag       780
     cacaacggca cgatcgagat cgactgccag ttctgcaacc aacgctatct gttcgatgcc       840
     actgacgtcg cgcagctgtt tgctggcggc ggtgtcgatt cgccatctga cacgcgccat       900
     taa                                                                     903
//

If you have problems or comments...

PBIL Back to PBIL home page