(data stored in ACNUC7421 zone)

EMBL: CP000075.PE175

CP000075.PE175       Location/Qualifiers
FT   CDS_pept        189651..189926
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Psyr_0175"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Psyr_0175"
FT                   /db_xref="EnsemblGenomes-Tr:AAY35248"
FT                   /db_xref="UniProtKB/TrEMBL:Q500C4"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAY35248.1"
FT                   /translation="MTDDIDNDEEDFAASTLIEAIENQIEAGNPPAARAVFNMLTLVNY
FT                   EREDILEMMAHVLAIEIDALLEQDRPFDTQWYEAALRALPDLPPEN"
     atgaccgacg acatcgataa tgacgaagaa gactttgctg cctcgacgct gatcgaagcc        60
     atcgaaaacc agatcgaagc cggtaacccg cccgcagcca gagcggtgtt caacatgctg       120
     accctggtga actatgagcg tgaagatatt cttgaaatga tggcgcatgt gttggccatc       180
     gagatcgatg ccttgctgga gcaggaccgt ccgttcgaca cgcaatggta tgaagcagcg       240
     ctgcgcgccc tgcccgacct gccgccggaa aattga                                 276
//

If you have problems or comments...

PBIL Back to PBIL home page