(data stored in ACNUC7421 zone)

EMBL: CP000075.PE179

CP000075.PE179       Location/Qualifiers
FT   CDS_pept        complement(194094..194330)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Psyr_0179"
FT                   /product="Protein of unknown function DUF1289"
FT                   /db_xref="EnsemblGenomes-Gn:Psyr_0179"
FT                   /db_xref="EnsemblGenomes-Tr:AAY35252"
FT                   /db_xref="InterPro:IPR010710"
FT                   /db_xref="UniProtKB/TrEMBL:Q500C0"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAY35252.1"
FT                   /translation="MSQSPVRPPKPLFSNVSPAVASPCISLCRLDEQKVCLGCFRHVED
FT                   IREWRSADDDRRRQIRHEADQRRARAEVDQAAG"
     gtgagccagt cccccgttcg accgcccaag ccgcttttca gcaatgtcag cccggcagta        60
     gcctcgccgt gtatcagcct gtgccggctc gatgagcaga aggtttgcct gggatgcttc       120
     cgtcatgtcg aagacatccg cgaatggcgc tcggccgatg acgaccggcg ccgccagatt       180
     cgccacgagg ccgatcagcg tcgagcccgc gccgaggttg accaggcggc aggctga          237
//

If you have problems or comments...

PBIL Back to PBIL home page