(data stored in ACNUC7421 zone)

EMBL: CP000075.PE180

CP000075.PE180       Location/Qualifiers
FT   CDS_pept        complement(194333..194665)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Psyr_0180"
FT                   /product="Frataxin-like protein"
FT                   /db_xref="EnsemblGenomes-Gn:Psyr_0180"
FT                   /db_xref="EnsemblGenomes-Tr:AAY35253"
FT                   /db_xref="GOA:Q500B9"
FT                   /db_xref="InterPro:IPR002908"
FT                   /db_xref="InterPro:IPR020895"
FT                   /db_xref="InterPro:IPR036524"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q500B9"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAY35253.1"
FT                   /translation="MSLTEARFHDLVDATQQNIEDVFDDSGLDVDLENSAGVLTVKFEG
FT                   GTQLIFSRQEPLRQLWLAARSGGFHFDYDEENQCWACDSSDELLSEMLERFTVEQAGVE
FT                   LDFSEI"
     atgagtttga ccgaagcccg ttttcacgac ctcgtcgatg cgacgcagca gaatatcgaa        60
     gacgtattcg atgacagtgg tctggatgtg gacctggaaa actcggccgg tgtactgacg       120
     gtcaagtttg aaggcggcac gcagcttatc ttcagccgtc aggagcccct gcgtcagctc       180
     tggctggcgg ccagatcggg tggttttcac ttcgactacg acgaagagaa tcagtgctgg       240
     gcctgcgatt ccagtgatga gctgctgagc gagatgctgg agcgctttac cgtcgagcag       300
     gccggtgtcg aactggactt ctccgagatc tga                                    333
//

If you have problems or comments...

PBIL Back to PBIL home page