(data stored in ACNUC7421 zone)

EMBL: CP000075.PE184

CP000075.PE184       Location/Qualifiers
FT   CDS_pept        197157..197891
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Psyr_0184"
FT                   /product="Protein of unknown function DUF484"
FT                   /db_xref="EnsemblGenomes-Gn:Psyr_0184"
FT                   /db_xref="EnsemblGenomes-Tr:AAY35257"
FT                   /db_xref="InterPro:IPR007435"
FT                   /db_xref="InterPro:IPR029016"
FT                   /db_xref="UniProtKB/TrEMBL:Q500B5"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAY35257.1"
FT                   /translation="MTDQPPASTGTPCESPVDSAAPDLEAEAVIAFLLEHPDFFAEHDE
FT                   LLVSMRIPHQRGDTVSLVERQLKLLRERNIEMRHRLSQLMDVARDNDRLFEKTRRLNLA
FT                   LMDATSLEELVIAVEDSLRQDFQVPFVSLILFSDSPMPVGRWVSGADAQKAIGGLIGEK
FT                   IICGALREHELAFLFGAEQGKEVGSTAIASLNHLGLHGVLAIGSRDPQHYKSSVGTLFL
FT                   SYIADVLSRLLPRFAHSLRSVR"
     atgaccgatc aacctcccgc ttcaacaggc acaccctgcg aatcgcctgt cgatagcgca        60
     gcgccagacc ttgaagcaga ggcggtcatc gccttcctgc tcgagcaccc ggacttcttc       120
     gccgagcacg acgagctgct ggtgtcgatg cgcattccgc accagcgtgg cgacaccgtt       180
     tcgctggtcg agcgtcagct caagctgctg cgcgagcgca atatcgaaat gcgccatcgc       240
     ctgtcgcaat tgatggacgt cgcacgggac aacgaccgcc tgttcgaaaa gacccgccgc       300
     ctgaacctcg cgctgatgga tgcgaccagt ctggaagagc tggtcatcgc cgtcgaagac       360
     agcctgcgtc aggacttcca ggtgcccttt gtcagcctga tcctgttcag cgacagcccg       420
     atgcccgtgg ggcgctgggt cagcggtgcc gacgcacaga aagccatcgg cggcctgatt       480
     ggcgagaaga tcatctgcgg cgcgctgcgt gagcatgaac tggcgtttct gttcggtgca       540
     gagcagggca aggaggtcgg ttcgactgcc atcgccagcc tcaatcatct gggcctgcat       600
     ggcgtgctgg ccatcggcag ccgtgatccg cagcattaca aaagctcggt cggcaccctg       660
     ttcctcagtt atatcgccga cgtgctgagc cgcctgctgc cgcgcttcgc ccactcatta       720
     cgctcggttc gctag                                                        735
//

If you have problems or comments...

PBIL Back to PBIL home page