(data stored in ACNUC7421 zone)

EMBL: CP000075.PE185

CP000075.PE185       Location/Qualifiers
FT   CDS_pept        197894..198793
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Psyr_0185"
FT                   /product="tyrosine recombinase XerC subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Psyr_0185"
FT                   /db_xref="EnsemblGenomes-Tr:AAY35258"
FT                   /db_xref="GOA:Q500B4"
FT                   /db_xref="InterPro:IPR002104"
FT                   /db_xref="InterPro:IPR004107"
FT                   /db_xref="InterPro:IPR010998"
FT                   /db_xref="InterPro:IPR011010"
FT                   /db_xref="InterPro:IPR011931"
FT                   /db_xref="InterPro:IPR013762"
FT                   /db_xref="InterPro:IPR023009"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q500B4"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAY35258.1"
FT                   /translation="MDQHLDAYCMHLRSERQVSPHTLEAYRRDLGKVLAYCQKAQVSSW
FT                   SDLDIQHLRSFTARQHQQGQSSRSLARMLSAVRGFYKYLNREGICQHDPANGLSPPKGE
FT                   RRLPKTLDTDRAAQLLDGGVEDDFLAHRDQAILELLYSSGLRLSELTGLNLDQLDLRDG
FT                   LVQVLGKGSKTRVLPVGSKARQALEVWLPLRALTNPQDDAVFVSQQGKRLGPRAIQVRL
FT                   KAAGERELGQNLHPHMLRHSFASHLLESSQDLRAVQELLGHADIKTTQIYTHLDFQHLA
FT                   TVYDSAHPRAKRKGTADD"
     atggatcagc atctggacgc ctactgcatg cacctgcgca gtgagcgcca ggtgtcgcct        60
     cacacgctgg aagcctaccg acgcgacctg ggtaaggtcc tggcgtattg ccagaaggca       120
     caggtgtcga gctggagtga cctggatatc cagcacctgc gcagcttcac tgcccgccag       180
     caccagcagg gccagtcttc acgcagcctg gcgaggatgc tgtcggcggt gcgcggcttc       240
     tacaagtacc tcaatcgcga aggcatctgc cagcacgacc cggcaaacgg tctgtcaccg       300
     cccaagggcg agcggcgtct gcccaagacc ctggacaccg accgcgccgc gcaattgctg       360
     gacggcggcg ttgaagatga tttcctggcg caccgcgacc aagccatcct ggagctgctg       420
     tactcgtcag ggttgcgcct ctccgaactg accggtctga atctggacca gctggacctg       480
     cgtgacggac tggtgcaggt gctgggtaag ggcagcaaga cccgcgtatt gcctgtgggc       540
     agcaaggcgc gccaggcact ggaagtctgg ctgccgctgc gcgccctgac caatccgcag       600
     gacgacgcgg tatttgtcag ccagcaaggc aagcgcctcg gcccgcgcgc cattcaggtg       660
     cgactcaagg cagccggtga gcgagagctg gggcagaatc tgcacccgca catgttgcgg       720
     cactccttcg ccagtcatct gctcgaatcg tcacaggacc tgcgcgccgt gcaggagctg       780
     cttggtcatg cggatattaa gaccacgcag atatatacac acctggactt ccagcatttg       840
     gctactgttt atgacagcgc ccatccccga gccaaacgta aaggaactgc agatgattaa       900
//

If you have problems or comments...

PBIL Back to PBIL home page