(data stored in ACNUC7421 zone)

EMBL: CP000075.PE187

CP000075.PE187       Location/Qualifiers
FT   CDS_pept        complement(199549..199875)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Psyr_0187"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Psyr_0187"
FT                   /db_xref="EnsemblGenomes-Tr:AAY35260"
FT                   /db_xref="UniProtKB/TrEMBL:Q500B2"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAY35260.1"
FT                   /translation="MSDDDDIKDDLEDDLEGEEDGEELAAAPGDDPVEVDDDVPAPAAK
FT                   GKAKAAVSVDELPSVEAKNKERDALARAMEEFLARGGKVQEVEANVVADPPKKPDNKYG
FT                   SRPI"
     atgagcgacg acgacgatat taaggacgat ctggaagacg acctggaagg cgaagaggac        60
     ggtgaggagc ttgcagctgc tcccggcgac gacccggtcg aagtagacga tgacgttccg       120
     gcacctgccg caaaaggcaa ggccaaggct gcagtctcgg tcgatgaact gcccagcgtg       180
     gaagccaaga acaaggagcg cgatgcgctg gcacgtgcca tggaagaatt cctggcgcgt       240
     ggcggcaagg tgcaggaagt ggaggccaac gtggtcgccg atccgcccaa gaagcctgac       300
     aacaaatacg gtagccgccc tatctga                                           327
//

If you have problems or comments...

PBIL Back to PBIL home page