(data stored in ACNUC7421 zone)

EMBL: CP000075.PE19

CP000075.PE19        Location/Qualifiers
FT   CDS_pept        complement(23040..23546)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Psyr_0019"
FT                   /product="peptide deformylase"
FT                   /EC_number="3.5.1.88"
FT                   /db_xref="EnsemblGenomes-Gn:Psyr_0019"
FT                   /db_xref="EnsemblGenomes-Tr:AAY35093"
FT                   /db_xref="GOA:Q500S9"
FT                   /db_xref="InterPro:IPR023635"
FT                   /db_xref="InterPro:IPR036821"
FT                   /db_xref="UniProtKB/TrEMBL:Q500S9"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAY35093.1"
FT                   /translation="MAILNILEFPDSRLRTIAKPVAMVDDGIRQLVDDMFETMYEAPGI
FT                   GLAATQVNVHKRVVVMDLSEDRSEPMVFINPEIEKLTDEMDQYQEGCLSVPGFYENVDR
FT                   PQKVRVKALDRDGKPYELVAEGLLAICIQHECDHLNGKLFVDYLSNLKRDRIKKKLEKQ
FT                   HKLNA"
     atggccattc taaacatcct cgaatttccc gattcgcgcc tgcgcaccat cgccaaacct        60
     gtggcgatgg tagacgacgg cattcgccag ttggtcgacg acatgtttga aaccatgtac       120
     gaagcgccag gtattggcct ggccgcgact caggtcaacg tccacaagcg cgtggtcgtc       180
     atggacctga gcgaagaccg tagcgaaccg atggtcttca tcaatcctga aatcgaaaaa       240
     ctgaccgatg aaatggatca gtatcaggaa ggctgcctgt cggtgccggg cttctacgag       300
     aacgtcgacc gtccgcaaaa ggtccgcgtc aaggcgctgg accgtgacgg caagccttat       360
     gaactggttg ccgagggcct gctcgccatc tgtatccagc atgaatgcga tcacctgaac       420
     ggcaagctgt tcgtcgatta cctgtccaac ctcaagcgtg accggatcaa gaagaagctc       480
     gaaaagcagc acaagctcaa cgcctga                                           507
//

If you have problems or comments...

PBIL Back to PBIL home page