(data stored in ACNUC7421 zone)

EMBL: CP000075.PE191

CP000075.PE191       Location/Qualifiers
FT   CDS_pept        202769..203044
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Psyr_0191"
FT                   /product="Protein of unknown function DUF526"
FT                   /db_xref="EnsemblGenomes-Gn:Psyr_0191"
FT                   /db_xref="EnsemblGenomes-Tr:AAY35264"
FT                   /db_xref="InterPro:IPR007475"
FT                   /db_xref="UniProtKB/TrEMBL:Q500A8"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAY35264.1"
FT                   /translation="MLAPKAFLDALSGHASRLFNGETPVSRNEFETQFKALLQSGFSKL
FT                   DLVSREEFDSQMAVLARTRARLEALEAKMAELEEKAGGAAGTEKAE"
     atgctcgcgc ccaaagcctt tctcgacgct ctcagcggcc acgcctctcg cctgttcaat        60
     ggcgaaacgc ctgtatcgcg caacgaattc gaaacccagt tcaaggccct gctgcaaagc       120
     ggcttcagca aactggatct ggtcagccgt gaagagttcg acagccagat ggccgtcctc       180
     gcccgcaccc gcgcccgcct ggaagcgctg gaggccaaga tggccgagct ggaagagaag       240
     gctggcgggg ccgcagggac tgaaaaagcc gaataa                                 276
//

If you have problems or comments...

PBIL Back to PBIL home page