(data stored in SCRATCH zone)

EMBL: CP000075.PE2

CP000075.PE2         Location/Qualifiers
FT   CDS_pept        1575..2678
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Psyr_0002"
FT                   /product="DNA polymerase III, beta subunit"
FT                   /EC_number="2.7.7.7"
FT                   /db_xref="EnsemblGenomes-Gn:Psyr_0002"
FT                   /db_xref="EnsemblGenomes-Tr:AAY35076"
FT                   /db_xref="GOA:Q500U6"
FT                   /db_xref="InterPro:IPR001001"
FT                   /db_xref="InterPro:IPR022634"
FT                   /db_xref="InterPro:IPR022635"
FT                   /db_xref="InterPro:IPR022637"
FT                   /db_xref="UniProtKB/TrEMBL:Q500U6"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAY35076.1"
FT                   /translation="MHFTIQREALLKPLQLVAGVVERRQTLPVLSNVLLVVEGQQLSLT
FT                   GTDLEVELVGRVQLEEPAEPGEITVPARKLMDICKSLSNDALIDIKLDDSKLIVKAGRS
FT                   RFTLSTLPANDFPTVEEGPGSLTFTLVQSKLRRLIERTSFAMAQQDVRYYLNGMLLEVS
FT                   AGILRAVATDGHRLAMCSMSADIEHADRHQVIVPRKGILEMARLLTEQDGTVSIVLGQH
FT                   HIRATTGEFTFTSKLVDGKFPDYERVLPKGGDKLVLGDRQALREAFSRTAILSNEKYRG
FT                   IRLQLASGQLKIQANNPEQEEAEEEISVEYNGDSLEIGFNVSYLLDVLGVMTTEQVRLI
FT                   LSDSNSSALVQESDNDDSAYVVMPMRL"
     atgcatttca ccattcaacg cgaagccctg ttgaaacccc tgcaattggt cgccggcgtc        60
     gtcgaacgcc gccagacctt gccggttctt tccaatgtgc tcctggtcgt cgaaggtcag       120
     caactgtcgc tgaccggtac ggatctggaa gtcgaactgg ttggccgcgt ccagctggaa       180
     gagcccgccg aacctggaga aatcacggtt cctgcgcgca agctcatgga catttgcaaa       240
     agcctgtcca atgacgcgct gatcgacatc aagctcgatg actcgaaact gatcgtcaag       300
     gccggtcgta gccggttcac cctgtcgact ctgcctgcca atgatttccc taccgttgaa       360
     gaaggcccgg gttcgctgac gttcactctg gtgcagagca aactgcgccg cttgatcgag       420
     cgcaccagct ttgcgatggc ccagcaggac gttcggtact acctcaacgg catgctgctt       480
     gaagtgagtg ccggtatctt gcgtgcggtt gccaccgacg gccaccgcct ggccatgtgc       540
     tcgatgtctg ccgatatcga acacgccgat cgccatcagg tgatcgttcc acgcaaaggt       600
     attcttgaaa tggcgcgcct gctgaccgaa caggacggca cggtcagtat cgttctgggt       660
     cagcatcaca tccgtgcgac gactggcgaa ttcaccttca cctccaaact ggtcgatggc       720
     aagttcccgg attacgagcg tgtgctgccc aaaggtggtg acaagctggt gctcggtgat       780
     cgtcaggcac tgcgtgaggc gttcagccgc acggcgattc tgtccaacga gaagtaccgc       840
     ggcatccgtc tgcaactggc cagcggtcaa ttgaagattc aggccaacaa ccctgagcag       900
     gaagaagcag aagaggaaat cagcgtcgag tacaacggtg actcgttgga gattggtttc       960
     aacgtgagct acttgctcga cgtgctgggc gtcatgacca ccgaacaggt gcgcctgatt      1020
     ctgtccgact ccaatagcag cgccctggtg caagagtccg ataacgacga ctccgcctac      1080
     gttgtcatgc cgatgcgtct gtaa                                             1104
//

If you have problems or comments...

PBIL Back to PBIL home page