(data stored in SCRATCH zone)

EMBL: CP000075.PE200

CP000075.PE200       Location/Qualifiers
FT   CDS_pept        complement(213976..215373)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Psyr_0200"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Psyr_0200"
FT                   /db_xref="EnsemblGenomes-Tr:AAY35273"
FT                   /db_xref="GOA:Q4ZZZ9"
FT                   /db_xref="InterPro:IPR007214"
FT                   /db_xref="InterPro:IPR013976"
FT                   /db_xref="InterPro:IPR014627"
FT                   /db_xref="InterPro:IPR036754"
FT                   /db_xref="UniProtKB/TrEMBL:Q4ZZZ9"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAY35273.1"
FT                   /translation="MTEVAHVNDPHHAPVVIRQLLEKLAISYNEVVDEKNLPPARKVQA
FT                   VLVEDAVGALLILFPQSQLLDLSRITELTGRQLTAVPHERLARMLTKHNLRVLPGLPAL
FT                   TSSPCLYDERLLQEPTLLVGSGEPGVLLEISSEDFKGMLSKASAAHFGQSVAAIRPNLD
FT                   RPDDDPAEITQAMHAFTARRIQQRLEATLEIPPLAGTAQKIIKLRVDPDATIDDITGVV
FT                   ETDPALAAQVVSWAASPYYASTGKIRSVEDAIVRVLGFDLVINLALGLALGKTLSLPKD
FT                   QPQQTTPYWQQSIYTAAVIEGLTRAIPRASRPEGGLSYLAGLLHNFGYLLLAHVFPPHF
FT                   TLICRQLEVNPHLHHSFIEQHLLGISREQIGAWLMRYWDMPDELAIALRFQHDPHYKGE
FT                   HHVYANLVYLAVRLLRANGIGSGPEQDIPDELFERLGLTREKANESVKKVLEAEVLLRE
FT                   LASQFSK"
     atgacagaag tcgcccacgt caatgatccg caccatgcgc cggtggtaat ccggcagttg        60
     cttgaaaagt tggctatcag ctacaacgaa gtcgtggacg aaaagaacct ccctccagcg       120
     cgcaaggtgc aggccgtgct ggtcgaggat gctgtcggtg cgttgcttat cctgtttccg       180
     caaagccagt tgctcgacct ctcccgcatt accgagctga ccggtcgcca actgaccgcc       240
     gtgccgcacg agcggctggc gcgcatgctg accaagcaca acctgcgcgt actgccaggt       300
     ctcccggcgc tgaccagctc accctgcctt tacgacgagc gcctgcttca ggagccaaca       360
     ctgctggtag gttcgggcga gcctggtgtt ctgctggaaa tcagcagcga ggacttcaag       420
     ggcatgctga gcaaggccag cgccgcgcac tttggtcagt ctgtggcggc gatccggccg       480
     aacctcgatc gtcctgacga cgatcctgca gaaatcactc aggccatgca tgccttcacg       540
     gcgcgccgca tccagcagcg tctggaagcg actctggaga ttccgccgct ggctggcact       600
     gcgcagaaaa tcatcaaact gcgtgtcgac cccgatgcaa ccatcgatga catcaccggc       660
     gtcgtcgaaa ccgatcccgc actggctgct caagtcgtca gctgggccgc ttcgccgtat       720
     tacgcgtcga ccggcaagat tcgttcggtc gaagacgcaa tcgtccgtgt actgggcttc       780
     gatctggtga tcaatctggc actggggctc gcactgggca aaaccctgag cctgcccaag       840
     gatcagccac aacagaccac gccgtactgg caacagtcca tctacaccgc tgccgtcatc       900
     gaaggcctga cccgtgccat tccgcgcgcc agccggccgg agggtggcct gagctacctc       960
     gccggcttgc tgcacaactt cggctacctg ctgctggcgc acgtgtttcc accgcacttc      1020
     accctgattt gccgccagct ggaagtgaac ccgcatttgc accacagctt tatcgagcag      1080
     catcttctgg gtatcagccg cgagcagatc ggggcctggc tgatgcgcta ttgggacatg      1140
     ccggatgagc tcgccatcgc attgcgtttc cagcacgacc cgcactacaa gggtgagcat      1200
     cacgtctatg ccaacctggt ctatctggcg gtgcgcctgc tgcgtgccaa cggtatcggc      1260
     tccggtcccg aacaggatat cccggacgaa ttgttcgaac gcctgggcct gacgcgcgaa      1320
     aaagccaacg aatcggtgaa aaaagtgctc gaggccgaag tgctgctgcg cgaactggcg      1380
     tcgcagttca gcaagtaa                                                    1398
//

If you have problems or comments...

PBIL Back to PBIL home page