(data stored in ACNUC7421 zone)

EMBL: CP000075.PE204

CP000075.PE204       Location/Qualifiers
FT   CDS_pept        complement(219306..219731)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Psyr_0204"
FT                   /product="outer membrane transport energization protein
FT                   ExbD"
FT                   /note="TC 2.C.1.1.1"
FT                   /db_xref="EnsemblGenomes-Gn:Psyr_0204"
FT                   /db_xref="EnsemblGenomes-Tr:AAY35277"
FT                   /db_xref="GOA:Q4ZZZ5"
FT                   /db_xref="InterPro:IPR003400"
FT                   /db_xref="InterPro:IPR014170"
FT                   /db_xref="UniProtKB/TrEMBL:Q4ZZZ5"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAY35277.1"
FT                   /translation="MGLHLNEGGDDLAENHEINVTPFIDVMLVLLIIFMVAAPLATVDI
FT                   KVDLPASTATPQPRPEKPIFLSVKTDKSLYLGEEKVAREQIGQVLDARTKGKKDTTIFF
FT                   QADKGVDYGDLMEVMNTLRGAGYLKVGLVGLETAGKK"
     gtgggcctgc atcttaacga aggcggcgac gatctcgccg agaaccatga aatcaacgtg        60
     acgccgttca tcgacgtcat gctggtgctg ctgatcatct tcatggtggc tgcaccgctg       120
     gcgaccgtgg acatcaaggt cgacctgcca gcgtccaccg ccacaccgca gcccagaccc       180
     gagaaaccga tctttctcag cgtgaaaacc gacaagagcc tgtacctggg cgaggagaag       240
     gttgctcgcg agcagatcgg tcaggtgctg gacgcccgca ccaagggcaa gaaagacacc       300
     acgatcttct tccaggccga caagggcgtg gattacggtg atctgatgga agtcatgaac       360
     acgcttcggg gtgcgggtta cctgaaggtc ggtctggtag gtcttgagac ggctggtaag       420
     aaatga                                                                  426
//

If you have problems or comments...

PBIL Back to PBIL home page