(data stored in SCRATCH zone)

EMBL: CP000075.PE206

CP000075.PE206       Location/Qualifiers
FT   CDS_pept        220906..221754
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Psyr_0206"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Psyr_0206"
FT                   /db_xref="EnsemblGenomes-Tr:AAY35279"
FT                   /db_xref="GOA:Q4ZZZ3"
FT                   /db_xref="InterPro:IPR001509"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:Q4ZZZ3"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAY35279.1"
FT                   /translation="MTAPSLLIAGCGDIGSRLATRLLPHGWTVHGLRRTVSELPAGVHG
FT                   VAGDLFETQKPAQWPAAALDYVVYCATPSQRDEAGYRMAYVEGLRNVLSWLEQTGQRPK
FT                   RLIFVSSSGVYGQQNGEWVDETSATEPGNYTGTVMLEAEQVALNSGLPATAVRLTGIYG
FT                   PGRSDLSNRVRQGHSVRIDPPVYANRIHADDAAGLLEHLLLADQRGVALESCYLGVDDD
FT                   PAALADVVAWIREYLGVTEWSEEVSVQRVGSKRCSNARARALGWAPMYPDFRAGYAALL
FT                   G"
     atgactgctc cttcgcttct gatcgccggc tgtggcgaca ttggttcgcg actcgctact        60
     cgcctgctgc ctcacggctg gaccgtgcat gggctgcggc gcactgtttc cgagcttcct       120
     gccggtgttc acggtgtggc gggcgatctg ttcgagacgc aaaaacctgc ccaatggcct       180
     gctgcagcat tggattacgt ggtgtattgc gcgaccccct cacaacgtga cgaagcgggt       240
     taccggatgg cttacgtcga gggcctgcgt aatgtgttga gctggctcga gcagaccggg       300
     cagcggccaa agcgcttgat cttcgtttca agcagcggtg tttacggtca gcagaatggg       360
     gaatgggtgg atgaaacctc cgccaccgag cccggcaact acaccggcac ggtgatgctg       420
     gaggccgagc aggtcgcgct gaacagcggg ctgccggcca cggcggtgag actgaccggt       480
     atttacggcc cgggccgcag tgacctgtcg aaccgcgtcc gccaggggca cagcgtgagg       540
     atcgatccgc cggtctacgc caatcgtatt catgccgacg atgcggccgg tctgctggag       600
     cacctgctgc tggcggatca acgcggcgtt gcgctggaga gttgctacct gggcgtcgac       660
     gacgatccgg ccgcgctggc cgatgtggtg gcgtggatcc gtgagtatct gggagtgacc       720
     gaatggtcgg aggaggtcag cgtgcagcgc gtgggcagca agcgttgcag taatgccagg       780
     gcgcgagcat tgggatgggc gccgatgtac ccggacttta gggcaggtta tgcggcttta       840
     ctgggctag                                                               849
//

If you have problems or comments...

PBIL Back to PBIL home page