(data stored in ACNUC7421 zone)

EMBL: CP000075.PE21

CP000075.PE21        Location/Qualifiers
FT   CDS_pept        24821..25939
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Psyr_0021"
FT                   /product="DNA protecting protein DprA"
FT                   /db_xref="EnsemblGenomes-Gn:Psyr_0021"
FT                   /db_xref="EnsemblGenomes-Tr:AAY35095"
FT                   /db_xref="GOA:Q500S7"
FT                   /db_xref="InterPro:IPR003488"
FT                   /db_xref="InterPro:IPR041614"
FT                   /db_xref="UniProtKB/TrEMBL:Q500S7"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAY35095.1"
FT                   /translation="MPLFENAPSSPAELEARLRMHRLPEIGPKRFSRLIEAFGSASSAL
FT                   SAPASAWRALGIPGACAEARRDPSVRDGASAALAWLERPAQHLLMWDDPGYPALLAQIA
FT                   DPPPLIFIAGDPSILERPQLGMVGSRRASRPGLDTASAFARSLAAAGFVITSGLARGID
FT                   GAAHQGALDVGGLTIGVLGTGLEKLYPQQHRALAAQIAAQGGAVISEFPLDAAAQASNF
FT                   PRRNRIISGLSLGILVVEASVASGSLITARLAAEHGREVYAIPGSIHHPGAKGCHQLIR
FT                   DGATLVETVEHILEGLQHWKRVTPDIDPVTPAKPVPCDHPLLALLHAAPHTSEGLSVSC
FT                   GWPLPKVLAGLTELELDGRISCEAGRWFARAP"
     atgccattgt tcgaaaatgc cccctcttca cccgcagagc tggaagcgcg tttgcgcatg        60
     caccgcttgc ccgagatagg gccgaaacgc ttttccagac tgatcgaagc cttcggttcg       120
     gcctcgtcgg cgctcagtgc gccggccagc gcatggcgtg cgctgggtat tcctggtgcc       180
     tgtgccgagg cgcgtcgtga cccctccgta cgtgatggcg ccagtgccgc attggcctgg       240
     ctggagcgtc cggcccagca tttgctgatg tgggacgacc ctggctaccc ggcattgctg       300
     gcgcagatcg ctgatccacc gccgctgatc ttcattgccg gcgacccttc gatcctggag       360
     cgtccgcagt tgggaatggt cggcagtcgt cgcgcttcac gacccgggct ggacaccgcc       420
     agcgcttttg cgcgcagcct ggcggctgcc ggttttgtga tcaccagtgg cctggcgcgg       480
     ggtattgacg gcgccgcgca tcagggcgca ttggatgtcg gggggcttac aatcggcgtg       540
     cttggcaccg ggctcgaaaa actttatcca cagcagcacc gcgccctcgc cgcgcagatc       600
     gcggcacagg gcggcgcagt gatttccgag ttcccgctgg acgccgcagc acaggccagc       660
     aacttcccgc ggcgtaaccg aatcatcagc ggcctgtcgc tgggcatact ggtggtcgag       720
     gccagtgtcg ccagcggctc gttgattacc gcgcgactgg ccgccgagca tggacgagag       780
     gtgtatgcga tacctggctc gattcatcac cctggcgcca agggctgtca tcagttgata       840
     cgtgacggcg cgacactggt cgagaccgtc gagcacattc ttgaaggctt gcagcactgg       900
     aaacgtgtta cgcccgacat cgatcctgtc acgccggcga agcctgtccc ttgcgatcat       960
     cctttattgg cgctgctgca cgccgcaccg cacaccagcg aggggctgtc ggtgtcatgc      1020
     ggctggccat tgcccaaggt attggcaggc ctgaccgagc tggaactgga cggacgcata      1080
     agctgtgaag caggacgatg gttcgccaga gcgccctga                             1119
//

If you have problems or comments...

PBIL Back to PBIL home page