(data stored in SCRATCH zone)

EMBL: CP000075.PE210

CP000075.PE210       Location/Qualifiers
FT   CDS_pept        complement(225170..225433)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Psyr_0210"
FT                   /product="DNA-directed RNA polymerase subunit omega"
FT                   /EC_number="2.7.7.6"
FT                   /db_xref="EnsemblGenomes-Gn:Psyr_0210"
FT                   /db_xref="EnsemblGenomes-Tr:AAY35283"
FT                   /db_xref="GOA:Q4ZZY9"
FT                   /db_xref="InterPro:IPR003716"
FT                   /db_xref="InterPro:IPR006110"
FT                   /db_xref="InterPro:IPR012293"
FT                   /db_xref="InterPro:IPR036161"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q4ZZY9"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAY35283.1"
FT                   /translation="MARVTVEDCLEHVDNRFELVMLSTKRARQLATGGKEPKLAWENDK
FT                   PTVMALREIAAGVMDYSVIAEAEIVEDEPLFAAFEDESNEAV"
     atggcccgcg taaccgttga agactgccta gaacacgtgg ataaccgctt tgagctggtc        60
     atgctctcta ccaagcgtgc ccgtcaactg gcaaccggcg gcaaagaacc aaagctggcc       120
     tgggaaaacg acaagcctac cgttatggcc ctgcgtgaaa tcgcggctgg cgtaatggat       180
     tactctgtaa tcgcagaagc tgaaatcgtt gaagatgagc cattgttcgc agcgttcgag       240
     gacgagtcca acgaggccgt ctaa                                              264
//

If you have problems or comments...

PBIL Back to PBIL home page