(data stored in ACNUC7421 zone)

EMBL: CP000075.PE217

CP000075.PE217       Location/Qualifiers
FT   CDS_pept        230111..230743
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Psyr_0217"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Psyr_0217"
FT                   /db_xref="EnsemblGenomes-Tr:AAY35290"
FT                   /db_xref="UniProtKB/TrEMBL:Q4ZZY2"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAY35290.1"
FT                   /translation="MAVGSRARFSVSGTLSALRALLAVVMLVPMLAQAADAPEPRLYRY
FT                   VDSRGVTVIDTQGVPPDYVAKGYEVLNSRGRVVQVVPPAPTAEQIRQSEADKRQAAADA
FT                   QLLSLYSSVAEVDRMKARKLAELDALVGVALGNIQGLAAQQRSLQGQAADLERAGRPVQ
FT                   QALVDQLNDLRDQQQKLQADIAGYQAARVKAEADFAVDRARVQRLTQ"
     atggcagtcg gcagcagggc acggttttcg gtttcaggca cgctgagcgc tttgcgggcc        60
     ttgctggctg tcgtcatgct tgtgcccatg ctcgctcagg ctgccgacgc acctgagcca       120
     cggctttatc gctacgtcga tagccgcggg gtgacggtga tcgacacgca aggcgtgccg       180
     cccgactacg ttgccaaagg ttatgaagtg ctcaacagtc gtggccgggt ggttcaggtt       240
     gtgccgcccg cgcctacggc cgagcagatt cgtcagtccg aggccgacaa gcgccaggct       300
     gccgccgatg cgcaactgct gagcctgtac agcagcgtcg ctgaagtgga tcgcatgaag       360
     gcccgcaaac tggccgagct ggacgcgctg gttggcgttg ccctgggcaa cattcagggg       420
     ctggcggcgc agcagcgcag tctgcagggc caggccgccg accttgagcg tgcaggacgt       480
     ccggttcagc aggcgcttgt cgatcaactg aacgacttgc gcgatcagca gcagaaactg       540
     caagccgata tcgccgggta tcaggccgca cgcgtaaagg ccgaagcaga cttcgccgtg       600
     gaccgcgccc gcgtccagcg gctgactcaa tga                                    633
//

If you have problems or comments...

PBIL Back to PBIL home page