(data stored in ACNUC7421 zone)

EMBL: CP000075.PE222

CP000075.PE222       Location/Qualifiers
FT   CDS_pept        236452..237126
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Psyr_0222"
FT                   /product="DNA replication and repair protein RadC"
FT                   /db_xref="EnsemblGenomes-Gn:Psyr_0222"
FT                   /db_xref="EnsemblGenomes-Tr:AAY35295"
FT                   /db_xref="GOA:Q4ZZX7"
FT                   /db_xref="InterPro:IPR001405"
FT                   /db_xref="InterPro:IPR010994"
FT                   /db_xref="InterPro:IPR020891"
FT                   /db_xref="InterPro:IPR025657"
FT                   /db_xref="InterPro:IPR037518"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q4ZZX7"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAY35295.1"
FT                   /translation="MSIRSWPAAERPRERLLELGAASLSDAELLAIFLRTGVAGKSAVD
FT                   LARHLLNQFDGLRPLLDADLSAFTSQLGLGPAKFAQLQAVMEMARRHMAESLRRESALE
FT                   NPTQVRSYLKALLRHEPHEVFGCLFLDNKHRVMTFEILFRGTINASYVHPRQVVKRAMA
FT                   HNAASLILCHNHPSGITTPSRSDIDLTKRLKEALLLVDVHVLDHVIVGDGEPLSMVERG
FT                   LM"
     atgagtattc gcagttggcc cgcggctgaa cgcccccggg aacgcttgtt ggagttgggg        60
     gcggcgagcc tttccgacgc cgagttgctg gctatctttt tacgcaccgg cgtggccgga       120
     aaaagcgctg tagaccttgc gcgtcatctg ctgaatcaat ttgacgggct cagaccgtta       180
     ctggatgcgg atctgtcggc attcacctcg caactggggc tcgggcctgc caagttcgct       240
     cagttgcagg ccgtgatgga aatggcgcgt cggcacatgg ccgagtccct gcgccgtgaa       300
     tcagcgctgg aaaacccgac ccaggttcgc agctatctca aggccctgct gcggcatgag       360
     ccgcacgaag tcttcggctg cctgtttctc gataacaagc accgggtcat gaccttcgag       420
     atattgtttc gcgggacgat caacgcgtct tatgtacacc cgcgccaggt ggtgaaacgc       480
     gcgatggcgc acaacgctgc cagcctgatt ctctgccaca accatccttc cggtatcacc       540
     acgcccagcc gttccgacat cgacctgacc aagcgcctca aggaagcact gctgctggtg       600
     gacgttcatg tgcttgacca cgtgatcgtg ggggacggcg agccactgtc gatggtggag       660
     cgcgggttga tgtag                                                        675
//

If you have problems or comments...

PBIL Back to PBIL home page