(data stored in ACNUC7421 zone)

EMBL: CP000075.PE225

CP000075.PE225       Location/Qualifiers
FT   CDS_pept        239456..239611
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Psyr_0225"
FT                   /product="LSU ribosomal protein L33P"
FT                   /db_xref="EnsemblGenomes-Gn:Psyr_0225"
FT                   /db_xref="EnsemblGenomes-Tr:AAY35298"
FT                   /db_xref="GOA:Q4ZZX4"
FT                   /db_xref="InterPro:IPR001705"
FT                   /db_xref="InterPro:IPR011332"
FT                   /db_xref="InterPro:IPR018264"
FT                   /db_xref="InterPro:IPR038584"
FT                   /db_xref="UniProtKB/TrEMBL:Q4ZZX4"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAY35298.1"
FT                   /translation="MRELIRLVSSAGTGHFYTTDKNKRTTPDKIEIKKFDPVVRKHVIY
FT                   KEGKIK"
     atgcgtgaat tgatccgttt ggtgtcgagc gctggtacag gccatttcta caccaccgac        60
     aagaacaaac gtactacccc ggataaaatc gaaatcaaaa aattcgatcc ggttgtacgc       120
     aagcacgtga tctacaaaga aggcaaaatc aagtaa                                 156
//

If you have problems or comments...

PBIL Back to PBIL home page