(data stored in ACNUC7421 zone)

EMBL: CP000075.PE226

CP000075.PE226       Location/Qualifiers
FT   CDS_pept        complement(239693..240061)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Psyr_0226"
FT                   /product="Protein of unknown function DUF861"
FT                   /db_xref="EnsemblGenomes-Gn:Psyr_0226"
FT                   /db_xref="EnsemblGenomes-Tr:AAY35299"
FT                   /db_xref="InterPro:IPR008579"
FT                   /db_xref="InterPro:IPR011051"
FT                   /db_xref="InterPro:IPR014710"
FT                   /db_xref="UniProtKB/TrEMBL:Q4ZZX3"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAY35299.1"
FT                   /translation="MSIESIVDFSEASTAAEHYRPAPEKVFKGDPAQTLYNHYNSPCGQ
FT                   MSAGVWNGEPGQWQVNYSEHEYCEIVQGVSVLRDEQGHAKTLRAGDRFVIPAGFKGTWE
FT                   VLETCRKIYVVFEAAADK"
     atgagcatcg aaagcatcgt cgacttcagt gaagccagca ccgccgccga gcactatcgc        60
     cctgcaccgg aaaaagtctt caagggcgac ccggcacaaa ccctctacaa ccactacaac       120
     agcccctgcg gacagatgag cgcgggcgtc tggaatggcg agcccgggca gtggcaggta       180
     aattattcgg agcatgagta ttgcgagatt gtgcagggtg tttcagtcct gcgcgacgag       240
     cagggccacg cgaaaaccct gcgcgcaggt gaccgcttcg tgatcccggc aggcttcaag       300
     ggtacttggg aggtgctgga aacatgccgc aagatttatg tggtgtttga ggcggctgca       360
     gataaataa                                                               369
//

If you have problems or comments...

PBIL Back to PBIL home page