(data stored in ACNUC7421 zone)

EMBL: CP000075.PE231

CP000075.PE231       Location/Qualifiers
FT   CDS_pept        246432..246683
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Psyr_0231"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Psyr_0231"
FT                   /db_xref="EnsemblGenomes-Tr:AAY35304"
FT                   /db_xref="InterPro:IPR009506"
FT                   /db_xref="UniProtKB/TrEMBL:Q4ZZW8"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAY35304.1"
FT                   /translation="MNGFSDVRLALHSQELNEYRPATVRTVRSNKADLLAGMGRWALYR
FT                   HRWASRRSLLTLTDDQLRDIGLDFRQARVEAMKPFWRP"
     atgaacgggt tcagcgatgt gcgccttgcg cttcacagcc aggaactgaa tgaatatcgg        60
     ccagcgacgg tcagaaccgt tcgctcgaac aaggccgatc tgttggcagg catggggcgc       120
     tgggcactgt atcgccatcg ctgggcatcg cgccgcagct tgctgacact gaccgacgat       180
     cagttgcgcg acattggcct ggatttccgc caggcgcggg tcgaggccat gaagccgttc       240
     tggaggccct ga                                                           252
//

If you have problems or comments...

PBIL Back to PBIL home page