(data stored in ACNUC7421 zone)

EMBL: CP000075.PE233

CP000075.PE233       Location/Qualifiers
FT   CDS_pept        248105..248458
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Psyr_0233"
FT                   /product="Protein of unknown function UPF0153"
FT                   /db_xref="EnsemblGenomes-Gn:Psyr_0233"
FT                   /db_xref="EnsemblGenomes-Tr:AAY35306"
FT                   /db_xref="InterPro:IPR005358"
FT                   /db_xref="InterPro:IPR016928"
FT                   /db_xref="UniProtKB/TrEMBL:Q4ZZW6"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAY35306.1"
FT                   /translation="MSCNRQKIADLRRQIPSFECVPGCHDCCGPVTTSPEEMSRLPRKT
FT                   AAEQEAALDELNCVHLGPQGCTVYDERPLICRLFGTTASLPCPNGRRPVELIHPRVEKQ
FT                   IHEYMASTRQVLV"
     atgagctgca accgtcagaa aatagcggat ctgcgtcgcc agattccttc gttcgaatgt        60
     gtgcccggct gccacgactg ctgcgggccg gtgaccacct cgcccgaaga aatgtcgcgt       120
     ctgccgcgca agacggccgc cgaacaggaa gctgcgctgg atgaactcaa ttgcgtacac       180
     cttgggccgc aaggctgcac cgtgtatgac gagcgcccgc tgatctgccg cctgttcggc       240
     accaccgcaa gcctgccctg cccgaatggc cgtcgcccgg tcgaactgat tcatccacgg       300
     gtcgaaaagc agatacacga atatatggcc tcgacccgcc aggtactcgt atag             354
//

If you have problems or comments...

PBIL Back to PBIL home page