(data stored in ACNUC7421 zone)

EMBL: CP000075.PE235

CP000075.PE235       Location/Qualifiers
FT   CDS_pept        249112..250413
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Psyr_0235"
FT                   /product="D-amino acid dehydrogenase small subunit"
FT                   /EC_number="1.4.99.1"
FT                   /db_xref="EnsemblGenomes-Gn:Psyr_0235"
FT                   /db_xref="EnsemblGenomes-Tr:AAY35308"
FT                   /db_xref="GOA:Q4ZZW4"
FT                   /db_xref="InterPro:IPR006076"
FT                   /db_xref="InterPro:IPR023080"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q4ZZW4"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAY35308.1"
FT                   /translation="MRVLVLGSGVIGTTSAYYLARAGFQVTVVDRQPAAAMETSFANAG
FT                   QVSPGYASPWAAPGVPLKALKWLLQRHAPLAIKATADIDQYLWMAQMLRNCTASRYAIN
FT                   KERMVRLSEYSRDCLDELRLETGIAYEGRSLGTTQLFRTQAQLDNAAKDIAVLEQSGVP
FT                   YELLDRDGIARVEPALAGVTGILSGALRLPNDQTGDCQLFTTRLAEMAVALGVEFRYGQ
FT                   NIERLDHAGDRINGVWIDGKLETADRYVLALGSYSPQLLKPLGIKAPVYPLKGYSLTVP
FT                   ITNPDMAPTSTILDETYKVAITRFDNRIRVGGMAEIAGFDLSLNPRRRETLEMIVGDLY
FT                   PQGGDLTQADFWTGLRPTTPDGTPIVGATPFRNLFLNTGHGTLGWTMACGSGRLLADLI
FT                   ARKTPRISAEGLDISRYGNTQENAQHVHPAPAHQ"
     atgcgcgttc tggtcctggg tagtggcgtc atcggtacaa ccagtgctta ttatctggcg        60
     cgtgccggtt tccaggtgac tgtcgttgac cgtcagcctg ctgctgccat ggaaaccagt       120
     tttgccaatg ccggccaggt ttctccgggc tatgcgtcgc catgggctgc gccgggtgtt       180
     ccgctcaaag ccctcaaatg gctgctgcag cgtcatgcgc cattggcgat caaggcaacg       240
     gcagatatcg atcagtacct gtggatggcg caaatgctgc gcaactgcac ggccagccgc       300
     tatgccatca ataaagagcg catggtacgc ctgtccgaat acagccgcga ttgcctggat       360
     gaactgcgcc tcgagaccgg cattgcctac gaaggacgca gcctgggcac cacacagttg       420
     ttccgtaccc aggcccagct ggataacgct gccaaggaca tcgccgtgct cgagcagtcc       480
     ggtgtgccct atgaactgct cgatcgcgac ggcattgccc gtgtcgagcc cgcgctggcc       540
     ggcgtgaccg gcatcctcag cggcgcgttg cgcctgccca acgaccagac tggtgactgt       600
     cagctgttca ccacgcgcct ggcggaaatg gccgtcgcgc tgggtgtcga gttccgctac       660
     gggcagaaca tcgaacgcct cgatcacgct ggcgaccgca ttaatggcgt gtggatcgac       720
     ggcaagctgg agaccgccga tcgttacgta ctggcgctgg gcagttactc gccgcagttg       780
     ctcaagccgc tgggcatcaa ggcaccggtc tatccgctga aaggctattc gctgaccgtg       840
     ccgatcacca acccggacat ggcaccgact tcgaccattc tcgatgaaac ctataaagtc       900
     gcgatcaccc gtttcgacaa tcggatccgc gtcggcggca tggcggaaat cgccggtttt       960
     gacctgtcgc tcaatccgcg tcgacgcgaa acactggaga tgatcgtcgg tgacctctat      1020
     cctcaaggcg gcgacctgac ccaggccgat ttctggaccg ggttgcgtcc gaccacgccc      1080
     gacggtacac cgattgtggg tgcgacaccg ttccgtaacc tgttcctcaa taccggccat      1140
     ggcaccctgg gctggacgat ggcgtgtggt tccggtcgtt tgctggcaga cctcatcgcc      1200
     cgcaagacac ctcgtatcag tgctgaaggc cttgatatct ctcgttacgg caatacccag      1260
     gagaatgcac agcatgtcca tccagcgcca gctcaccaat ga                         1302
//

If you have problems or comments...

PBIL Back to PBIL home page