(data stored in ACNUC7421 zone)

EMBL: CP000075.PE238

CP000075.PE238       Location/Qualifiers
FT   CDS_pept        251961..252560
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Psyr_0238"
FT                   /product="Helix-turn-helix motif protein"
FT                   /db_xref="EnsemblGenomes-Gn:Psyr_0238"
FT                   /db_xref="EnsemblGenomes-Tr:AAY35311"
FT                   /db_xref="GOA:Q4ZZW1"
FT                   /db_xref="InterPro:IPR001387"
FT                   /db_xref="InterPro:IPR010982"
FT                   /db_xref="InterPro:IPR011051"
FT                   /db_xref="InterPro:IPR013096"
FT                   /db_xref="InterPro:IPR014710"
FT                   /db_xref="UniProtKB/TrEMBL:Q4ZZW1"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAY35311.1"
FT                   /translation="MMAFTSTRPDKTWGNIALDVGERLQSIRKLKGLSQRELAKRAGVT
FT                   NSTISMIEKNSVSPSISSLRKVLGGIPMSMVEFFSEESVPENAAQVVYKASELIDISDG
FT                   AVTMKLVGKSHQGRAIAFLTETYPPGADTGEEMLVHEGEETGILVEGRLELVVGLDTYV
FT                   LEAGDSYYFESTRPHRFRNPFDVPARLISAATPANF"
     atgatggcgt tcacatcgac tagacctgac aaaacctggg ggaatatcgc attggacgtg        60
     ggtgaacgac tgcaatcgat tcgcaagctc aaaggcttgt cccagcgtga actcgccaag       120
     cgcgcaggtg tgaccaacag caccatctcc atgatcgaaa aaaacagcgt cagcccttcg       180
     atcagttcgc tgcgcaaggt gctcggcggc atccccatgt ccatggtcga atttttctcg       240
     gaagagtccg tgcccgaaaa cgcggctcaa gtggtctaca aggccagcga gctgattgat       300
     atatcggacg gtgccgtgac catgaagctg gtcggcaaat cgcatcaggg ccgtgccatc       360
     gcctttctca ccgaaaccta tccaccgggt gccgataccg gcgaagagat gctcgtccac       420
     gaaggcgaag agaccggcat cctcgtcgag gggcggctgg aactggtggt cgggctggat       480
     acctacgtgc tcgaagcggg tgacagctat tatttcgaaa gcacccggcc gcatcgcttt       540
     cgtaacccgt tcgacgtccc ggcacgattg atcagtgcgg ccaccccggc caatttctga       600
//

If you have problems or comments...

PBIL Back to PBIL home page