(data stored in ACNUC7421 zone)

EMBL: CP000075.PE240

CP000075.PE240       Location/Qualifiers
FT   CDS_pept        252906..253160
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Psyr_0240"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Psyr_0240"
FT                   /db_xref="EnsemblGenomes-Tr:AAY35313"
FT                   /db_xref="UniProtKB/TrEMBL:Q4ZZV9"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAY35313.1"
FT                   /translation="MRCTLVPVPERPALCMRFMGASRATLRLLAKMMFRSMHFGDSTHP
FT                   FREQVRSYALWAEARKPFVPGVSGIVYNDNALRDEHAAL"
     gtgaggtgca ccctcgttcc cgtgcctgag cgcccggcgc tgtgcatgcg ttttatggga        60
     gcgagccggg caacgcttcg cctgctcgcg aagatgatgt ttagatcgat gcattttggc       120
     gatagtacac acccttttcg cgaacaagtt cgctcctacg ccctttgggc agaagccagg       180
     aagccttttg ttccgggtgt ttcagggatt gtgtataacg ataatgctct gcgtgacgag       240
     catgcagcac tttga                                                        255
//

If you have problems or comments...

PBIL Back to PBIL home page