(data stored in ACNUC7421 zone)

EMBL: CP000075.PE241

CP000075.PE241       Location/Qualifiers
FT   CDS_pept        253210..255141
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Psyr_0241"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Psyr_0241"
FT                   /db_xref="EnsemblGenomes-Tr:AAY35314"
FT                   /db_xref="InterPro:IPR026888"
FT                   /db_xref="InterPro:IPR037171"
FT                   /db_xref="InterPro:IPR038460"
FT                   /db_xref="UniProtKB/TrEMBL:Q4ZZV8"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAY35314.1"
FT                   /translation="MPYSCSIEHAVDHVLAQLPEHIHLGMPLGLGKPNRFVNALYQRIS
FT                   ELPERRLTIYTALTLGRPTPGEGLQARFLEPFLERVFADYPELDFLAALRRDKLPANIH
FT                   VQQFFMQPGSLLNSHSAQQDYVSSNYSHAARDINANGLNLVAQLVARDEQHPGTLSLSC
FT                   NPDVTLDLLPMIAKRRAAGETILMLGQVHADLPYMPGDSELDVDAFDVLIDEDERSTLF
FT                   STPNMPVGYQDHLIGLHASTLVRDGGTLQIGIGSMGDALTGALLARQADNETWRGLLAE
FT                   LNMSNWQTLIDREGGVQPFASGLYGCSEMFVNGLLVLADAGVVRRKVYADAELQRLANM
FT                   GTLDEDAHPGGVVVHGGFFLGPRSFYARLRELPAERLAQFNMTAISYINELYGQEELKR
FT                   LQRRDARFINSAFTVTLMGAAVADQLEDGRVLSGVGGQYNFVAQAHALEGARSILMLRS
FT                   WRESGGEVSSNIVWQYGHTTIPRHLRDIVVTEYGIADLRGQTDAMVIERILNITDSRFQ
FT                   SGLIEQAQKAGKLPKDFRLDPRFTDNTPERLKDTASRYPSLFTEYPLGCDFTAEERDLL
FT                   RALNWLKSKLKLTEILELGKATLDAPDPEAFLAHLQRMQLDAPQGLREELYQRLLLAGL
FT                   QNSTGLAG"
     atgccgtatt cctgttccat cgagcatgcc gtcgatcacg ttctggcgca gctacccgag        60
     catatccacc tggggatgcc gctggggctg ggcaagccca accggttcgt caacgcgttg       120
     taccagcgca tcagcgagtt gcccgaacga cggctgacga tctacaccgc gctgacactc       180
     gggcggccga cgccggggga gggtttgcag gcgcgctttc tcgaaccgtt tctggagcgc       240
     gtcttcgctg actatccgga gctcgatttc ctcgctgcac tgcgccgcga caaactccct       300
     gccaatatcc atgtgcagca attcttcatg cagccgggca gtttgctcaa cagccactca       360
     gcccagcaag actacgtcag cagcaattac agccatgccg cccgcgacat caatgccaac       420
     ggcctgaatc tggttgcgca actggtggcc cgtgacgaac aacacccggg cacgctgagt       480
     ctgagctgta acccggacgt gaccctcgac ctgttgccca tgatcgccaa gcgccgggcc       540
     gccggggaga ccattctgat gctcggccag gtgcacgccg acctgcctta catgccgggc       600
     gattcggaac tggatgtcga cgccttcgat gtgctgattg acgaagacga gcgcagtacg       660
     ctgttttcca ctcccaatat gccggtgggc tatcaggacc acctgatcgg cctgcacgcc       720
     agcacgctgg tgcgtgacgg cggcacgtta cagatcggca tcggctcgat gggcgatgca       780
     ctgactggcg cgctgctggc tcgccaggcc gataacgaaa cctggcgcgg cctgctggcc       840
     gagttgaaca tgagtaactg gcagaccctg atagatcggg aaggtggcgt tcagccgttc       900
     gccagcggcc tttacggttg cagcgaaatg ttcgtcaacg gcctgctggt actcgccgac       960
     gcgggcgtcg tgcggcgcaa ggtgtatgcc gatgcagaac tgcaacggct ggccaacatg      1020
     ggcacgctgg atgaggatgc ccatcccggt ggcgttgtcg tgcatggcgg ctttttcctc      1080
     ggcccgcgca gtttttacgc gcggctgcgc gagctgcccg ccgagcggct ggcacagttc      1140
     aacatgaccg ccatcagcta catcaacgag ctttacggcc aggaagaact caagcgcctg      1200
     caacgccgcg atgcgcgctt catcaacagc gcgtttaccg tcaccctgat gggcgcggca      1260
     gtggctgatc agctggaaga cggccgggtg ctcagtggcg tgggcggtca gtacaacttc      1320
     gtggcgcagg cccatgcact ggaaggcgcc cgttcgattc tgatgctgcg cagctggcgt      1380
     gagtcgggcg gcgaggtcag ctccaacatc gtctggcagt atggccacac caccattccc      1440
     cgacacttgc gcgacattgt cgtgaccgaa tacggcatcg ccgatctgcg tgggcagacc      1500
     gatgcgatgg tgatcgagcg gattctgaac atcaccgact cgcggtttca atcgggcctg      1560
     atcgagcagg cgcaaaaggc tggcaagcta cccaaggact tccgtctcga tccgcgcttc      1620
     actgacaaca cacccgagcg cctcaaggac accgcatcac gctacccgtc actgtttacc      1680
     gaatacccgc tgggttgcga ctttaccgcc gaggagcgcg acctgctgag agccttgaac      1740
     tggctgaaga gcaagctcaa gctcactgaa atcctcgagc tgggcaaggc gaccctcgac      1800
     gctccggacc ccgaagcctt cctcgcgcac ttgcagcgca tgcagctcga cgcgccgcag      1860
     ggcttgcgcg aagagttgta tcagcggctg ttgctggccg ggttgcagaa cagcaccggg      1920
     cttgccggtt aa                                                          1932
//

If you have problems or comments...

PBIL Back to PBIL home page