(data stored in ACNUC7421 zone)

EMBL: CP000075.PE242

CP000075.PE242       Location/Qualifiers
FT   CDS_pept        complement(255189..255713)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Psyr_0242"
FT                   /product="Protein of unknown function DUF962"
FT                   /db_xref="EnsemblGenomes-Gn:Psyr_0242"
FT                   /db_xref="EnsemblGenomes-Tr:AAY35315"
FT                   /db_xref="GOA:Q4ZZV7"
FT                   /db_xref="InterPro:IPR009305"
FT                   /db_xref="UniProtKB/TrEMBL:Q4ZZV7"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAY35315.1"
FT                   /translation="MKTLVDHLSQYAAYHRDSRNIVTHFVGIPLIVLAVAVLLSRPGWT
FT                   VSGLWLSPAALLALGSTVFYLRLDRALGMVMAVLLALCIWAGANLAQQATMVWLSAGVG
FT                   LFVIGWIIQFVGHYYEGRKPAFIDDLTGLIIGPLFVVAELAFLMGQRKALQHAIEERAG
FT                   PVGRATRKATT"
     atgaaaaccc ttgtcgatca tctcagccaa tacgcggctt atcaccgtga ttcacgcaat        60
     atcgtgacgc acttcgtggg tattccactg atcgtgctgg ccgtggcggt gcttctctcg       120
     cgaccgggct ggactgtcag cgggctgtgg ctttcacctg cggcgctgct ggcgctgggc       180
     tcgacggtgt tttacctgcg actcgatcgc gccctgggca tggtcatggc ggtgttactg       240
     gcgctgtgta tctgggccgg ggccaacctt gcgcagcagg caaccatggt ctggctgagt       300
     gcgggcgtcg ggctctttgt gattggctgg atcatccagt tcgtcggcca ttactacgag       360
     gggcgcaaac cggccttcat cgatgacctg accgggctga tcatcggccc gttgtttgtg       420
     gtcgcggagc tggcgttcct gatgggccag cgcaaagctc tgcagcacgc catcgaagag       480
     cgcgcgggcc cggtggggcg tgcgacccgc aaggcaacga cctag                       525
//

If you have problems or comments...

PBIL Back to PBIL home page