(data stored in ACNUC7421 zone)

EMBL: CP000075.PE243

CP000075.PE243       Location/Qualifiers
FT   CDS_pept        255795..256505
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Psyr_0243"
FT                   /product="cyclic nucleotide-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:Psyr_0243"
FT                   /db_xref="EnsemblGenomes-Tr:AAY35316"
FT                   /db_xref="InterPro:IPR000595"
FT                   /db_xref="InterPro:IPR014710"
FT                   /db_xref="InterPro:IPR018490"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:Q4ZZV6"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAY35316.1"
FT                   /translation="MTNGVSWRSRLLSDYWFSHLPADLQDSLLDAARQRRKTPGRRLFE
FT                   KGDLPCGVYVLLEGSVRIGAAHEQRLLTNVEPASAPCWFGEVSLFDGLPRRFEVCSLEQ
FT                   SIFLHIPQPFLARLLDRHSEYWRWFAALLSQKVGLPLQSPEKMRQLPPRARVAWRLLML
FT                   SEGYGPLSHARRLIALDDIQAAERLALASPALLEVLQDLHERRIVRLGEGHLEVFDVDR
FT                   LRRVANFSRARAVC"
     atgacaaatg gagtgtcgtg gcggtcacga ttgctatccg attactggtt ttcccatctg        60
     cctgccgatc tgcaggacag cctgctggac gctgcccgcc agcgacgcaa gacgcccggc       120
     aggcggctgt tcgagaaggg cgatctgccc tgcggtgttt atgtgctgct ggagggcagc       180
     gtgcggatcg gcgccgccca cgagcagcgg ctgctgacga acgtggaacc tgcaagcgcg       240
     ccgtgctggt ttggcgaagt ctcgctgttt gacgggctgc cgcgccgttt cgaagtctgc       300
     tcgcttgagc agagcatctt cctgcacatc ccccagccat tcctggcccg gctgctcgac       360
     aggcactccg agtactggcg ctggtttgcc gcactgctca gtcagaaggt cggcttgcca       420
     ctgcagagcc ccgagaaaat gcgtcagctg ccgccgcggg cgcgggtcgc ctggcggctg       480
     ttgatgctca gcgaggggta tggcccgttg agccacgcac gccgcctgat tgcgctggat       540
     gacattcagg cggcggagcg tcttgcgctt gcctcgccgg ccttgctgga agtactccag       600
     gacctgcatg agcgcaggat cgtgcgcctg ggagagggac acctggaggt gttcgatgtg       660
     gacaggctgc gcagggtggc gaacttttcc agagccaggg ctgtgtgctg a                711
//

If you have problems or comments...

PBIL Back to PBIL home page