(data stored in ACNUC7421 zone)

EMBL: CP000075.PE244

CP000075.PE244       Location/Qualifiers
FT   CDS_pept        256622..257623
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Psyr_0244"
FT                   /product="extracellular solute-binding protein, family 1"
FT                   /db_xref="EnsemblGenomes-Gn:Psyr_0244"
FT                   /db_xref="EnsemblGenomes-Tr:AAY35317"
FT                   /db_xref="GOA:Q4ZZV5"
FT                   /db_xref="InterPro:IPR026045"
FT                   /db_xref="UniProtKB/TrEMBL:Q4ZZV5"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAY35317.1"
FT                   /translation="MQASKRLLAALTLTLLGSTAQAADEVVVYSSRIDELIKPVFDAYT
FT                   ASTGVKIKFITDKEAPLMQRIKAEGENATADLLLTVDAGNLWQAERMGILQPFTSPVIE
FT                   ANILPQYRSSSHGWTGLSLRARTIAYSTDRVKPAELSTYEALADKNWEGRLCLRTAKKV
FT                   YNQSLTATLIETHGAEASEKILKGWVNNLSTDVFSDDIAVLEAINAGQCDVGIVNSYYY
FT                   GRLHKEKPGLAVKLFWPNQADRGVHVNLSGIGLTKYAPHPEAAKSLVEWMTGPEAQKIF
FT                   SSVNQEFPANPNVAPSEEVASWGPFKADTLPVEVAGKRQAEAIRMMDRAGWN"
     atgcaggcaa gcaagcgtct tctggctgct ctgacactga ctttactggg cagcaccgct        60
     caggctgccg atgaagtggt ggtgtattcg tcccggatcg acgaactgat caagccggta       120
     ttcgatgcgt acacggccag taccggggtg aagatcaaat tcatcaccga caaggaagcg       180
     ccgctgatgc agcgcatcaa ggccgagggc gagaatgcca ccgccgacct gttgctgacg       240
     gtcgatgcgg gcaacctctg gcaggccgag cggatgggta tcctgcagcc gtttacctcg       300
     cctgtgatcg aagccaacat tctgccgcag tatcgctcgt cgagccacgg ctggaccggt       360
     ctgagccttc gcgcgcggac catcgcctac tccaccgacc gggtgaagcc tgccgagctg       420
     agcacctacg aggcgctggc cgacaagaac tgggaaggcc gtctgtgcct gcgtaccgcg       480
     aagaaggtct acaaccagtc gctgaccgct acgctgatcg aaacccacgg cgccgaagcg       540
     tcggagaaaa tcctcaaggg ctgggtcaac aacctgtcca ccgacgtgtt ctccgatgac       600
     atcgcggtgc ttgaggcgat caatgccggg cagtgcgacg tgggtatcgt caattcctat       660
     tactacggtc gcctgcacaa ggaaaaaccg ggtctggcgg tgaagctgtt ctggcctaac       720
     caggctgatc gcggtgtgca cgtcaacctg tcgggtatcg gtctgaccaa atacgctccg       780
     catcctgaag ccgccaagtc gctggtcgag tggatgaccg gccccgaggc gcagaagatt       840
     ttctccagcg tcaatcagga gttcccggcc aacccgaacg tggcgccttc agaagaagtg       900
     gccagctggg ggccgttcaa ggccgacacc ctcccggtcg aagtggcagg caagcgtcag       960
     gcagaagcga tacgcatgat ggatcgcgcg ggctggaatt ga                         1002
//

If you have problems or comments...

PBIL Back to PBIL home page